+ USE_DATABASE_REPLICATED=0
+ USE_SHARED_CATALOG=0
++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=Europe/Stockholm
+ echo 'Chosen random timezone Europe/Stockholm'
+ ln -snf /usr/share/zoneinfo/Europe/Stockholm /etc/localtime
Chosen random timezone Europe/Stockholm
+ echo Europe/Stockholm
+ dpkg -i package_folder/clickhouse-common-static_24.8.14.10504.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 48426 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.8.14.10504.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static (24.8.14.10504.altinitytest) ...
Setting up clickhouse-common-static (24.8.14.10504.altinitytest) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10504.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 48453 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10504.altinitytest_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.8.14.10504.altinitytest) ...
Setting up clickhouse-common-static-dbg (24.8.14.10504.altinitytest) ...
+ dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10504.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-odbc-bridge.
(Reading database ... 48460 files and directories currently installed.)
Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10504.altinitytest_amd64.deb ...
Unpacking clickhouse-odbc-bridge (24.8.14.10504.altinitytest) ...
Setting up clickhouse-odbc-bridge (24.8.14.10504.altinitytest) ...
+ dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10504.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-library-bridge.
(Reading database ... 48466 files and directories currently installed.)
Preparing to unpack .../clickhouse-library-bridge_24.8.14.10504.altinitytest_amd64.deb ...
Unpacking clickhouse-library-bridge (24.8.14.10504.altinitytest) ...
Setting up clickhouse-library-bridge (24.8.14.10504.altinitytest) ...
+ dpkg -i package_folder/clickhouse-server_24.8.14.10504.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 48472 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.8.14.10504.altinitytest_amd64.deb ...
Unpacking clickhouse-server (24.8.14.10504.altinitytest) ...
Setting up clickhouse-server (24.8.14.10504.altinitytest) ...
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.8.14.10504.altinitytest_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 48489 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.8.14.10504.altinitytest_amd64.deb ...
Unpacking clickhouse-client (24.8.14.10504.altinitytest) ...
Setting up clickhouse-client (24.8.14.10504.altinitytest) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.8.14.10504.altinitytest (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
+++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ source /utils.lib
++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
+ mkdir -p /etc/clickhouse-server/config.d/
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml
+ value=1
+ sed --follow-symlinks -i 's|[01]|1|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=29818880
+ sed --follow-symlinks -i 's|[[:digit:]]\+|29818880|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=29210624
+ sed --follow-symlinks -i 's|[[:digit:]]\+|29210624|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ '' == \1 ]]
+ [[ '' == \1 ]]
+ [[ -n 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3)
Runtime: go1.22.5 linux/amd64
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Copyright: 2015-2024 MinIO, Inc.
+ wait_for_it
+ local counter=0
+ ./minio server --address :11111 ./minio_data
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ local params
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
trying to connect to minio
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
INFO: Formatting 1st pool, 1 set(s), 1 drives per set.
INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable.
MinIO Object Storage Server
Copyright: 2015-2025 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:39253 http://127.0.0.1:39253
Docs: https://min.io/docs/minio/linux/index.html
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDenied
Access Denied./18639DCE1947383B7dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 295 root 8u IPv4 20373 0t0 TCP localhost:11111 (LISTEN)
minio 295 root 9u IPv6 20374 0t0 TCP *:11111 (LISTEN)
minio 295 root 10u IPv6 20375 0t0 TCP localhost:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy attach clickminio readwrite --user=test
Attached Policies: [readwrite]
To User: test
+ ./mc mb --ignore-existing clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc anonymous set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
+ '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']'
+ ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 155.12 MiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 125M
drwxr-xr-x 1 root root 4.0K Sep 9 14:43 .
drwxr-xr-x 1 root root 4.0K Sep 9 14:43 ..
-rw-rw-r-- 1 1000 1000 119 Sep 9 14:38 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2.4K Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 1.3K Sep 9 14:43 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Sep 9 14:43 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.4K Sep 9 14:43 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Sep 9 14:43 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Sep 9 14:38 broken_tests.json
drwxr-xr-x 14 root root 3.8K Sep 9 14:42 dev
-rwxr-xr-x 1 root root 0 Sep 9 14:42 .dockerenv
drwxr-xr-x 1 root root 4.0K Sep 9 14:43 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26M Jan 31 2025 mc
drwxr-xr-x 2 root root 4.0K Sep 11 2024 media
-rwxr-xr-x 1 root root 99M Jan 31 2025 minio
drwxr-xr-x 4 root root 4.0K Sep 9 14:43 minio_data
drwxr-xr-x 2 root root 4.0K Sep 11 2024 mnt
drwxr-xr-x 1 root root 4.0K Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Sep 9 14:42 package_folder
dr-xr-xr-x 315 root root 0 Sep 9 14:42 proc
-rwxrwxr-x 1 root root 9.5K Jan 31 2025 process_functional_tests_result.py
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
drwx------ 1 root root 4.0K Sep 9 14:43 root
drwxr-xr-x 1 root root 4.0K Sep 9 14:43 run
-rwxrwxr-x 1 root root 22K Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Sep 11 2024 srv
-rw-rw-r-- 1 root root 14K Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Sep 9 14:42 sys
drwxrwxr-x 2 1000 1000 4.0K Sep 9 14:42 test_output
drwxrwxrwt 1 root root 4.0K Jan 31 2025 tmp
drwxr-xr-x 1 root root 4.0K Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
drwxr-xr-x 1 root root 4.0K Sep 11 2024 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 426 clickhouse 322u IPv4 20406 0t0 TCP localhost:12222 (LISTEN)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ export IS_FLAKY_CHECK=0
+ IS_FLAKY_CHECK=0
+ '[' 1 -gt 1 ']'
+ sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
127.0.0.1 - - [09/Sep/2025:12:43:21 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 -
127.0.0.1 - - [09/Sep/2025:12:43:21 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:12:43:21 +0000] "PUT /devstoreaccount1/cont/vgrripmntwvzsxwqhptirizpuvqcazww HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:12:43:21 +0000] "GET /devstoreaccount1/cont/vgrripmntwvzsxwqhptirizpuvqcazww HTTP/1.1" 206 4
127.0.0.1 - - [09/Sep/2025:12:43:21 +0000] "GET /devstoreaccount1/cont/vgrripmntwvzsxwqhptirizpuvqcazww HTTP/1.1" 206 2
127.0.0.1 - - [09/Sep/2025:12:43:21 +0000] "DELETE /devstoreaccount1/cont/vgrripmntwvzsxwqhptirizpuvqcazww HTTP/1.1" 202 -
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
1
+ break
+ setup_logs_replication
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ attach_gdb_to_clickhouse
++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ [[ ahxB =~ e ]]
++ set_e=false
++ set +e
++ local total_retries=5
++ shift
++ local retry=0
++ '[' 0 -ge 5 ']'
++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ false
++ return
+ IS_ASAN=0
+ [[ 0 = \1 ]]
++ kill -l SIGRTMIN
+ RTMIN=34
+ echo '
set follow-fork-mode parent
handle SIGHUP nostop noprint pass
handle SIGINT nostop noprint pass
handle SIGQUIT nostop noprint pass
handle SIGPIPE nostop noprint pass
handle SIGTERM nostop noprint pass
handle SIGUSR1 nostop noprint pass
handle SIGUSR2 nostop noprint pass
handle SIG34 nostop noprint pass
info signals
continue
backtrace full
info registers
p top' 1 KiB of the 'stack:
p/x *(uint64_t[128]*)$sp
maintenance info sections
thread apply all backtrace full
disassemble /s
up
disassemble /s
up
disassemble /s
p "done"
detach
quit
'
+ sleep 5
+ ts '%Y-%m-%d %H:%M:%S'
++ cat /var/run/clickhouse-server/clickhouse-server.pid
+ gdb -batch -command script.gdb -p 616
+ run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=60
+ shift
+ local retry=0
+ '[' 0 -ge 60 ']'
+ clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
Connected to clickhouse-server after attaching gdb
+ true
+ set -e
+ return
+ clickhouse-client --query 'CREATE TABLE minio_audit_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ clickhouse-client --query 'CREATE TABLE minio_server_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ max_retries=100
+ retry=1
+ '[' 1 -le 100 ']'
+ echo 'clickminio restart attempt 1:'
clickminio restart attempt 1:
++ ./mc admin service restart clickminio --wait --json
++ jq -r .status
INFO: Restarting on service signal
MinIO Object Storage Server
Copyright: 2015-2025 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:33501 http://127.0.0.1:33501
Docs: https://min.io/docs/minio/linux/index.html
Output of restart status: success
success
Restarted clickminio successfully.
+ output='success
success'
+ echo 'Output of restart status: success
success'
+ expected_output='success
success'
+ '[' 'success
success' = 'success
success' ']'
+ echo 'Restarted clickminio successfully.'
+ break
+ '[' 1 -gt 100 ']'
+ MC_ADMIN_PID=1504
+ ./mc admin trace clickminio
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ run_tests
+ set -x
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ 0 -eq 1 ]]
+ [[ '' -eq 1 ]]
+ [[ 0 -eq 1 ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n 0 ]]
+ [[ -n 2 ]]
+ ADDITIONAL_OPTIONS+=('--run-by-hash-num')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM")
+ ADDITIONAL_OPTIONS+=('--run-by-hash-total')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL")
+ HIGH_LEVEL_COVERAGE=NO
+ [[ -n '' ]]
+ [[ NO = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ true
+ set -e
+ return
+ set +e
+ TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}")
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats
+ ts '%Y-%m-%d %H:%M:%S'
+ tee -a test_output/test_result.txt
2025-09-09 14:43:35 Using queries from '/usr/share/clickhouse-test/queries' directory
2025-09-09 14:43:35 Connecting to ClickHouse server... OK
2025-09-09 14:43:35 Connected to server 24.8.14.10504.altinitytest @ 47ca18fc15f95cf1ab84efa6baa9699b95dcf505 HEAD
2025-09-09 14:43:36 Found 3251 parallel tests and 281 sequential tests
2025-09-09 14:43:36 Running about 406 stateless tests (Process-10).
2025-09-09 14:43:36 00054_join_string: [ OK ] 0.32 sec.
2025-09-09 14:43:36 Running about 406 stateless tests (Process-9).
2025-09-09 14:43:36 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.37 sec.
2025-09-09 14:43:36 Running about 406 stateless tests (Process-6).
2025-09-09 14:43:36 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.47 sec.
2025-09-09 14:43:37 00942_mv_rename_table: [ OK ] 0.37 sec.
2025-09-09 14:43:37 00590_limit_by_column_removal: [ OK ] 0.27 sec.
2025-09-09 14:43:37 Running about 406 stateless tests (Process-8).
2025-09-09 14:43:37 01520_client_print_query_id: [ OK ] 0.82 sec.
2025-09-09 14:43:37 Running about 406 stateless tests (Process-4).
2025-09-09 14:43:37 00484_preferred_max_column_in_block_size_bytes: [ OK ] 0.97 sec.
2025-09-09 14:43:37 01251_string_comparison: [ OK ] 0.32 sec.
2025-09-09 14:43:37 Running about 406 stateless tests (Process-7).
2025-09-09 14:43:37 00265_http_content_type_format_timezone: [ OK ] 1.12 sec.
2025-09-09 14:43:37 03046_column_in_block_array_join: [ OK ] 0.37 sec.
2025-09-09 14:43:37 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ OK ] 0.67 sec.
2025-09-09 14:43:37 Running about 406 stateless tests (Process-3).
2025-09-09 14:43:37 01882_total_rows_approx: [ OK ] 1.52 sec.
2025-09-09 14:43:38 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.42 sec.
2025-09-09 14:43:38 01641_memory_tracking_insert_optimize: [ OK ] 0.67 sec.
2025-09-09 14:43:38 01475_read_subcolumns_2: [ OK ] 0.57 sec.
2025-09-09 14:43:38 02387_parse_date_as_datetime: [ OK ] 0.39 sec.
2025-09-09 14:43:38 01622_constraints_simple_optimization: [ OK ] 0.82 sec.
2025-09-09 14:43:38 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.32 sec.
2025-09-09 14:43:39 02158_ztest_cmp: [ OK ] 1.67 sec.
2025-09-09 14:43:39 01069_materialized_view_alter_target_table: [ OK ] 0.37 sec.
2025-09-09 14:43:39 02310_generate_multi_columns_with_uuid: [ OK ] 0.32 sec.
2025-09-09 14:43:39 01504_rocksdb: [ OK ] 1.92 sec.
2025-09-09 14:43:39 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.37 sec.
2025-09-09 14:43:39 02915_sleep_large_uint: [ OK ] 0.37 sec.
2025-09-09 14:43:39 02890_describe_table_options: [ OK ] 0.42 sec.
2025-09-09 14:43:39 01268_procfs_metrics: [ OK ] 0.97 sec.
2025-09-09 14:43:39 01940_point_in_polygon_ubsan: [ OK ] 0.33 sec.
2025-09-09 14:43:39 00700_decimal_arithm: [ OK ] 1.77 sec.
2025-09-09 14:43:39 02916_csv_infer_numbers_from_strings: [ OK ] 0.32 sec.
2025-09-09 14:43:39 00715_bounding_ratio_merge_empty: [ OK ] 0.32 sec.
2025-09-09 14:43:40 02474_extract_fixedstring_from_json: [ OK ] 0.37 sec.
2025-09-09 14:43:40 01100_split_by_string: [ OK ] 0.37 sec.
2025-09-09 14:43:40 00974_full_outer_join: [ OK ] 0.32 sec.
2025-09-09 14:43:40 00071_insert_fewer_columns: [ OK ] 0.32 sec.
2025-09-09 14:43:40 01621_sort_after_join_pipeline_stuck: [ OK ] 0.37 sec.
2025-09-09 14:43:40 00417_kill_query: [ OK ] 3.63 sec.
2025-09-09 14:43:40 01768_extended_range: [ OK ] 0.37 sec.
2025-09-09 14:43:40 02293_h3_hex_ring: [ OK ] 0.47 sec.
2025-09-09 14:43:40 00024_unused_array_join_in_subquery: [ OK ] 0.32 sec.
2025-09-09 14:43:40 02734_big_int_from_float_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:43:40 00152_totals_in_subquery: [ OK ] 0.32 sec.
2025-09-09 14:43:40 01825_new_type_json_add_column: [ OK ] 0.52 sec.
2025-09-09 14:43:41 00709_virtual_column_partition_id: [ OK ] 0.42 sec.
2025-09-09 14:43:41 01593_insert_settings: [ OK ] 0.42 sec.
2025-09-09 14:43:41 02705_projection_and_ast_optimizations_bug: [ OK ] 0.32 sec.
2025-09-09 14:43:41 01070_h3_to_parent: [ OK ] 0.32 sec.
2025-09-09 14:43:41 02995_bad_formatting_union_intersect: [ OK ] 0.32 sec.
2025-09-09 14:43:41 03014_msan_parse_date_time: [ OK ] 0.37 sec.
2025-09-09 14:43:41 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.37 sec.
2025-09-09 14:43:41 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 1.92 sec.
2025-09-09 14:43:41 00534_functions_bad_arguments2: [ SKIPPED ] 0.00 sec.
2025-09-09 14:43:41 Reason: not running for current build
2025-09-09 14:43:41 03095_merge_and_buffer_tables: [ OK ] 0.37 sec.
2025-09-09 14:43:41 02793_implicit_pretty_format_settings: [ OK ] 0.87 sec.
2025-09-09 14:43:42 02174_cte_scalar_cache: [ OK ] 0.77 sec.
2025-09-09 14:43:42 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.47 sec.
2025-09-09 14:43:42 02522_different_types_in_storage_merge: [ OK ] 0.47 sec.
2025-09-09 14:43:42 02346_position_countsubstrings_zero_byte: [ OK ] 0.37 sec.
2025-09-09 14:43:42 02235_add_part_offset_virtual_column: [ OK ] 1.42 sec.
2025-09-09 14:43:42 00700_decimal_with_default_precision_and_scale: [ OK ] 0.37 sec.
2025-09-09 14:43:42 01083_match_zero_byte: [ OK ] 0.32 sec.
2025-09-09 14:43:42 02151_lc_prefetch: [ SKIPPED ] 0.00 sec.
2025-09-09 14:43:42 Reason: not running for current build
2025-09-09 14:43:42 01562_agg_null_for_empty_ahead: [ OK ] 0.52 sec.
2025-09-09 14:43:42 01622_defaults_for_url_engine: [ OK ] 0.82 sec.
2025-09-09 14:43:43 01925_merge_prewhere_table: [ OK ] 0.37 sec.
2025-09-09 14:43:43 02021_create_database_with_comment: [ OK ] 3.18 sec.
2025-09-09 14:43:43 00876_wrong_arraj_join_column: [ OK ] 0.37 sec.
2025-09-09 14:43:43 01923_ttl_with_modify_column: [ OK ] 0.47 sec.
2025-09-09 14:43:43 01457_order_by_nulls_first: [ OK ] 0.47 sec.
2025-09-09 14:43:43 02999_variant_suspicious_types: [ OK ] 0.33 sec.
2025-09-09 14:43:43 02477_age: [ OK ] 0.57 sec.
2025-09-09 14:43:44 00712_prewhere_with_alias_bug: [ OK ] 0.37 sec.
2025-09-09 14:43:44 03169_display_column_names_in_footer: [ OK ] 0.37 sec.
2025-09-09 14:43:44 00125_array_element_of_array_of_tuple: [ OK ] 0.32 sec.
2025-09-09 14:43:44 01825_type_json_from_map: [ OK ] 2.08 sec.
2025-09-09 14:43:44 02011_normalize_utf8: [ OK ] 0.52 sec.
2025-09-09 14:43:44 01017_in_unconvertible_complex_type: [ OK ] 0.37 sec.
2025-09-09 14:43:44 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.37 sec.
2025-09-09 14:43:44 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.32 sec.
2025-09-09 14:43:45 02962_indexHint_rpn_construction: [ OK ] 0.37 sec.
2025-09-09 14:43:45 01374_if_nullable_filimonov: [ OK ] 0.37 sec.
2025-09-09 14:43:45 00564_initial_column_values_with_default_expression: [ OK ] 0.37 sec.
2025-09-09 14:43:46 02270_errors_in_files: [ OK ] 3.58 sec.
2025-09-09 14:43:46 03064_analyzer_named_subqueries: [ OK ] 0.37 sec.
2025-09-09 14:43:46 00952_basic_constraints: [ OK ] 4.74 sec.
2025-09-09 14:43:46 02185_arraySlice_negative_offset_size: [ OK ] 0.37 sec.
2025-09-09 14:43:46 02430_initialize_aggregation_with_combinators: [ OK ] 0.32 sec.
2025-09-09 14:43:46 01634_sum_map_nulls: [ OK ] 0.42 sec.
2025-09-09 14:43:46 01345_array_join_LittleMaverick: [ OK ] 0.37 sec.
2025-09-09 14:43:46 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 2.63 sec.
2025-09-09 14:43:46 02864_restore_table_with_broken_part: [ OK ] 2.32 sec.
2025-09-09 14:43:47 01010_pm_join_all_join_bug: [ OK ] 0.47 sec.
2025-09-09 14:43:47 01549_low_cardinality_materialized_view: [ OK ] 0.32 sec.
2025-09-09 14:43:47 00596_limit_on_expanded_ast: [ OK ] 0.87 sec.
2025-09-09 14:43:47 02111_global_context_temporary_tables: [ OK ] 0.47 sec.
2025-09-09 14:43:47 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.52 sec.
2025-09-09 14:43:47 01945_system_warnings: [ OK ] 2.27 sec.
2025-09-09 14:43:47 00834_date_datetime_cmp: [ OK ] 0.37 sec.
2025-09-09 14:43:47 02292_nested_not_flattened_detach: [ OK ] 0.32 sec.
2025-09-09 14:43:47 02999_analyzer_preimage_null: [ OK ] 0.37 sec.
2025-09-09 14:43:47 02304_grouping_set_order_by: [ OK ] 0.38 sec.
2025-09-09 14:43:47 03015_optimize_final_rmt: [ OK ] 5.08 sec.
2025-09-09 14:43:48 00052_all_left_join: [ OK ] 0.37 sec.
2025-09-09 14:43:48 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.52 sec.
2025-09-09 14:43:48 02954_analyzer_fuzz_i57086: [ OK ] 0.32 sec.
2025-09-09 14:43:48 00034_fixed_string_to_number: [ OK ] 0.32 sec.
2025-09-09 14:43:48 02521_analyzer_array_join_crash: [ OK ] 0.47 sec.
2025-09-09 14:43:48 01225_drop_dictionary_as_table: [ OK ] 0.32 sec.
2025-09-09 14:43:48 02901_remove_nullable_crash_analyzer: [ OK ] 0.42 sec.
2025-09-09 14:43:48 02916_set_formatting: [ OK ] 0.27 sec.
2025-09-09 14:43:48 03006_join_on_inequal_expression_2: [ OK ] 1.22 sec.
2025-09-09 14:43:48 02311_normalize_utf8_constant: [ OK ] 0.32 sec.
2025-09-09 14:43:48 02675_sparse_columns_clear_column: [ OK ] 0.82 sec.
2025-09-09 14:43:49 02751_multiquery_with_argument: [ OK ] 2.12 sec.
2025-09-09 14:43:49 01700_system_zookeeper_path_in: [ OK ] 0.42 sec.
2025-09-09 14:43:49 01746_extract_text_from_html: [ OK ] 0.57 sec.
2025-09-09 14:43:49 02184_storage_add_support_ttl: [ OK ] 0.52 sec.
2025-09-09 14:43:49 01603_decimal_mult_float: [ OK ] 0.42 sec.
2025-09-09 14:43:49 02351_Map_combinator_dist: [ OK ] 0.52 sec.
2025-09-09 14:43:49 01137_sample_final: [ OK ] 0.37 sec.
2025-09-09 14:43:50 01073_bad_alter_partition: [ OK ] 0.42 sec.
2025-09-09 14:43:50 00700_decimal_complex_types: [ OK ] 1.22 sec.
2025-09-09 14:43:50 02910_object-json-crash-add-column: [ OK ] 0.47 sec.
2025-09-09 14:43:50 01412_group_array_moving_shard: [ OK ] 0.62 sec.
2025-09-09 14:43:50 01769_extended_range_2: [ OK ] 0.42 sec.
2025-09-09 14:43:50 02910_nullable_enum_cast: [ OK ] 0.37 sec.
2025-09-09 14:43:50 02122_parallel_formatting_Markdown: [ OK ] 2.18 sec.
2025-09-09 14:43:50 01655_sleep_infinite_float: [ OK ] 0.32 sec.
2025-09-09 14:43:50 00180_attach_materialized_view: [ OK ] 0.32 sec.
2025-09-09 14:43:51 01710_projections_group_by_no_key: [ OK ] 0.38 sec.
2025-09-09 14:43:51 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.52 sec.
2025-09-09 14:43:51 02908_filesystem_cache_as_collection: [ OK ] 0.37 sec.
2025-09-09 14:43:51 02122_parallel_formatting_JSONCompactStrings: [ OK ] 3.13 sec.
2025-09-09 14:43:51 02990_format_select_from_explain: [ OK ] 0.57 sec.
2025-09-09 14:43:51 02816_check_projection_metadata: [ OK ] 0.32 sec.
2025-09-09 14:43:51 01715_table_function_view_fix: [ OK ] 0.32 sec.
2025-09-09 14:43:51 01825_type_json_mutations: [ OK ] 0.42 sec.
2025-09-09 14:43:51 02968_mysql_prefer_column_name_to_alias: [ OK ] 0.62 sec.
2025-09-09 14:43:52 03003_analyzer_setting: [ OK ] 0.47 sec.
2025-09-09 14:43:52 02531_two_level_aggregation_bug: [ OK ] 1.42 sec.
2025-09-09 14:43:52 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.52 sec.
2025-09-09 14:43:52 02504_regexp_dictionary_ua_parser: [ OK ] 3.48 sec.
2025-09-09 14:43:53 02902_topKGeneric_deserialization_memory: [ OK ] 0.32 sec.
2025-09-09 14:43:53 02233_HTTP_ranged: [ OK ] 1.32 sec.
2025-09-09 14:43:53 01655_window_functions_bug: [ OK ] 0.37 sec.
2025-09-09 14:43:53 00616_final_single_part: [ OK ] 0.57 sec.
2025-09-09 14:43:53 03126_column_not_under_group_by: [ OK ] 0.37 sec.
2025-09-09 14:43:53 02025_subcolumns_compact_parts: [ OK ] 0.42 sec.
2025-09-09 14:43:53 01942_dateTimeToSnowflakeID: [ OK ] 0.67 sec.
2025-09-09 14:43:54 01472_many_rows_in_totals: [ OK ] 0.47 sec.
2025-09-09 14:43:54 00335_bom: [ OK ] 0.67 sec.
2025-09-09 14:43:54 00439_fixed_string_filter: [ OK ] 0.32 sec.
2025-09-09 14:43:54 02562_native_tskv_default_for_omitted_fields: [ OK ] 4.88 sec.
2025-09-09 14:43:54 03041_analyzer_gigachad_join: [ OK ] 0.42 sec.
2025-09-09 14:43:55 01475_fix_bigint_shift: [ OK ] 0.37 sec.
2025-09-09 14:43:55 00961_check_table: [ OK ] 0.57 sec.
2025-09-09 14:43:55 01848_partition_value_column: [ OK ] 0.52 sec.
2025-09-09 14:43:55 02380_insert_mv_race: [ OK ] 2.27 sec.
2025-09-09 14:43:56 02422_insert_different_granularity: [ OK ] 0.72 sec.
2025-09-09 14:43:56 02708_dotProduct: [ OK ] 0.72 sec.
2025-09-09 14:43:56 03008_filter_projections_non_deterministoc_functions: [ OK ] 0.67 sec.
2025-09-09 14:43:56 00362_great_circle_distance: [ OK ] 0.37 sec.
2025-09-09 14:43:57 01710_force_use_projection: [ OK ] 0.42 sec.
2025-09-09 14:43:57 01274_alter_rename_column_distributed: [ OK ] 0.52 sec.
2025-09-09 14:43:57 01811_storage_buffer_flush_parameters: [ OK ] 3.17 sec.
2025-09-09 14:43:57 02971_functions_to_subcolumns_map: [ OK ] 0.37 sec.
2025-09-09 14:43:57 00586_removing_unused_columns_from_subquery: [ OK ] 0.47 sec.
2025-09-09 14:43:57 02843_date_predicate_optimizations_bugs: [ OK ] 0.32 sec.
2025-09-09 14:43:58 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.37 sec.
2025-09-09 14:43:58 00758_array_reverse: [ OK ] 0.42 sec.
2025-09-09 14:43:58 02118_deserialize_whole_text: [ OK ] 6.89 sec.
2025-09-09 14:43:59 01675_distributed_bytes_to_delay_insert: [ OK ] 5.08 sec.
2025-09-09 14:43:59 02291_dictionary_scalar_subquery_reload: [ OK ] 0.62 sec.
2025-09-09 14:43:59 02416_keeper_map: [ OK ] 1.02 sec.
2025-09-09 14:43:59 01010_pmj_on_disk: [ OK ] 0.37 sec.
2025-09-09 14:44:00 01854_HTTP_dict_decompression: [ OK ] 0.97 sec.
2025-09-09 14:44:00 02579_fill_empty_chunk_analyzer: [ OK ] 0.32 sec.
2025-09-09 14:44:00 03202_dynamic_null_map_subcolumn: [ OK ] 1.22 sec.
2025-09-09 14:44:00 02124_insert_deduplication_token_replica: [ OK ] 0.52 sec.
2025-09-09 14:44:01 00147_alter_nested_default: [ OK ] 0.42 sec.
2025-09-09 14:44:01 03033_cte_numbers_memory: [ OK ] 0.47 sec.
2025-09-09 14:44:01 00098_f_union_all: [ OK ] 0.42 sec.
2025-09-09 14:44:01 00964_bloom_index_string_functions: [ OK ] 10.44 sec.
2025-09-09 14:44:01 02346_to_hour_monotonicity_fix: [ OK ] 0.37 sec.
2025-09-09 14:44:02 02815_join_algorithm_setting: [ OK ] 0.97 sec.
2025-09-09 14:44:03 01889_clickhouse_client_config_format: [ OK ] 1.77 sec.
2025-09-09 14:44:03 01576_alias_column_rewrite: [ OK ] 0.77 sec.
2025-09-09 14:44:03 02969_functions_to_subcolumns_if_null: [ OK ] 0.37 sec.
2025-09-09 14:44:03 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.42 sec.
2025-09-09 14:44:03 01610_client_spawn_editor: [ OK ] 0.12 sec.
2025-09-09 14:44:04 00580_cast_nullable_to_non_nullable: [ OK ] 0.37 sec.
2025-09-09 14:44:04 01018_ddl_dictionaries_select: [ OK ] 0.67 sec.
2025-09-09 14:44:04 02771_skip_empty_files: [ OK ] 2.62 sec.
2025-09-09 14:44:04 03008_deduplication_wrong_mv: [ OK ] 0.32 sec.
2025-09-09 14:44:04 03273_dynamic_pretty_json_serialization: [ OK ] 0.32 sec.
2025-09-09 14:44:05 02933_compare_with_bool_as_string: [ OK ] 0.32 sec.
2025-09-09 14:44:05 00280_hex_escape_sequence: [ OK ] 0.32 sec.
2025-09-09 14:44:07 02661_read_from_archive_targz: [ OK ] 10.69 sec.
2025-09-09 14:44:07 00945_bloom_filter_index: [ OK ] 3.38 sec.
2025-09-09 14:44:07 01961_roaring_memory_tracking: [ OK ] 2.48 sec.
2025-09-09 14:44:07 02578_ipv4_codec_t64: [ OK ] 0.37 sec.
2025-09-09 14:44:07 01926_order_by_desc_limit: [ OK ] 2.78 sec.
2025-09-09 14:44:08 02975_intdiv_with_decimal: [ OK ] 0.52 sec.
2025-09-09 14:44:08 00701_join_default_strictness: [ OK ] 0.42 sec.
2025-09-09 14:44:08 00060_date_lut: [ OK ] 0.32 sec.
2025-09-09 14:44:08 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.52 sec.
2025-09-09 14:44:08 00662_array_has_nullable: [ OK ] 0.52 sec.
2025-09-09 14:44:08 Running about 406 stateless tests (Process-5).
2025-09-09 14:44:08 00763_long_lock_buffer_alter_destination_table: [ OK ] 32.45 sec.
2025-09-09 14:44:09 00515_enhanced_time_zones: [ OK ] 0.87 sec.
2025-09-09 14:44:09 02461_welch_t_test_fuzz: [ OK ] 0.32 sec.
2025-09-09 14:44:09 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.32 sec.
2025-09-09 14:44:09 02251_last_day_of_month: [ OK ] 0.37 sec.
2025-09-09 14:44:09 03032_save_bad_json_escape_sequences: [ OK ] 0.32 sec.
2025-09-09 14:44:09 00105_shard_collations: [ OK ] 0.47 sec.
2025-09-09 14:44:09 01418_index_analysis_bug: [ OK ] 0.42 sec.
2025-09-09 14:44:09 01024__getScalar: [ OK ] 0.32 sec.
2025-09-09 14:44:09 02265_per_table_ttl_mutation_on_change: [ OK ] 0.47 sec.
2025-09-09 14:44:09 02347_rank_corr_nan: [ OK ] 0.32 sec.
2025-09-09 14:44:09 00936_crc_functions: [ OK ] 0.42 sec.
2025-09-09 14:44:10 00271_agg_state_and_totals: [ OK ] 0.37 sec.
2025-09-09 14:44:10 01601_proxy_protocol: [ OK ] 0.52 sec.
2025-09-09 14:44:10 03204_distributed_with_scalar_subquery: [ OK ] 0.37 sec.
2025-09-09 14:44:10 01603_remove_column_ttl: [ OK ] 0.32 sec.
2025-09-09 14:44:10 02792_alter_table_modify_comment: [ OK ] 0.72 sec.
2025-09-09 14:44:10 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.37 sec.
2025-09-09 14:44:10 01556_explain_select_with_union_query: [ OK ] 0.43 sec.
2025-09-09 14:44:11 01403_datetime64_constant_arg: [ OK ] 0.32 sec.
2025-09-09 14:44:11 00720_with_cube: [ OK ] 0.52 sec.
2025-09-09 14:44:11 01655_plan_optimizations: [ OK ] 14.25 sec.
2025-09-09 14:44:11 01852_hints_enum_name: [ OK ] 1.02 sec.
2025-09-09 14:44:11 02875_parallel_replicas_cluster_all_replicas: [ OK ] 0.80 sec.
2025-09-09 14:44:11 02158_proportions_ztest_cmp: [ OK ] 1.57 sec.
2025-09-09 14:44:12 01567_system_processes_current_database: [ OK ] 0.32 sec.
2025-09-09 14:44:12 00457_log_tinylog_stripelog_nullable: [ OK ] 0.62 sec.
2025-09-09 14:44:12 03215_multilinestring_geometry: [ OK ] 0.37 sec.
2025-09-09 14:44:12 02110_clickhouse_local_custom_tld: [ OK ] 0.67 sec.
2025-09-09 14:44:12 01213_alter_rename_nested: [ OK ] 0.42 sec.
2025-09-09 14:44:12 02550_client_connections_credentials: [ OK ] 13.60 sec.
2025-09-09 14:44:12 02479_analyzer_aggregation_crash: [ OK ] 0.42 sec.
2025-09-09 14:44:12 02912_group_array_sample: [ OK ] 0.32 sec.
2025-09-09 14:44:13 00752_low_cardinality_array_result: [ OK ] 0.32 sec.
2025-09-09 14:44:13 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 1.82 sec.
2025-09-09 14:44:13 02730_with_fill_by_sorting_prefix: [ OK ] 0.62 sec.
2025-09-09 14:44:13 00321_pk_set: [ OK ] 0.62 sec.
2025-09-09 14:44:13 02267_output_format_prometheus: [ OK ] 0.37 sec.
2025-09-09 14:44:14 02900_matview_create_to_errors: [ OK ] 0.72 sec.
2025-09-09 14:44:14 02918_analyzer_to_ast_crash: [ OK ] 0.37 sec.
2025-09-09 14:44:15 01054_random_printable_ascii_ubsan: [ OK ] 2.92 sec.
2025-09-09 14:44:15 01425_decimal_parse_big_negative_exponent: [ OK ] 0.57 sec.
2025-09-09 14:44:15 02974_backup_query_format_null: [ OK ] 1.87 sec.
2025-09-09 14:44:15 03173_distinct_combinator_alignment: [ OK ] 0.47 sec.
2025-09-09 14:44:16 02539_settings_alias: [ OK ] 3.28 sec.
2025-09-09 14:44:16 00700_decimal_formats: [ OK ] 0.57 sec.
2025-09-09 14:44:16 00050_any_left_join: [ OK ] 0.32 sec.
2025-09-09 14:44:16 01053_drop_database_mat_view: [ OK ] 0.42 sec.
2025-09-09 14:44:16 03165_distinct_with_window_func_crash: [ OK ] 0.37 sec.
2025-09-09 14:44:16 03150_url_hash_non_constant_level: [ OK ] 0.32 sec.
2025-09-09 14:44:16 02456_aggregate_state_conversion: [ OK ] 0.32 sec.
2025-09-09 14:44:16 03032_numbers_zeros: [ OK ] 0.42 sec.
2025-09-09 14:44:16 02129_skip_quoted_fields: [ OK ] 9.39 sec.
2025-09-09 14:44:17 01673_test_toMinute_mysql_dialect: [ OK ] 0.32 sec.
2025-09-09 14:44:17 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec.
2025-09-09 14:44:17 Reason: not running for current build
2025-09-09 14:44:17 02479_nullable_primary_key_non_first_column: [ OK ] 0.37 sec.
2025-09-09 14:44:17 02354_vector_search_queries: [ OK ] 0.57 sec.
2025-09-09 14:44:17 00260_like_and_curly_braces: [ OK ] 0.47 sec.
2025-09-09 14:44:17 01051_new_any_join_engine: [ OK ] 0.72 sec.
2025-09-09 14:44:18 00384_column_aggregate_function_insert_from: [ OK ] 0.42 sec.
2025-09-09 14:44:18 00932_array_intersect_bug: [ OK ] 0.37 sec.
2025-09-09 14:44:18 00926_adaptive_index_granularity_merge_tree: [ OK ] 1.17 sec.
2025-09-09 14:44:18 02477_age_date32: [ OK ] 0.67 sec.
2025-09-09 14:44:18 02428_combinators_with_over_statement: [ OK ] 0.37 sec.
2025-09-09 14:44:18 02325_dates_schema_inference: [ OK ] 0.62 sec.
2025-09-09 14:44:18 02458_datediff_date32: [ OK ] 0.67 sec.
2025-09-09 14:44:19 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.42 sec.
2025-09-09 14:44:19 01277_large_tuples: [ OK ] 0.32 sec.
2025-09-09 14:44:19 03150_grouping_sets_use_nulls_pushdown: [ OK ] 0.42 sec.
2025-09-09 14:44:20 01550_type_map_formats_input: [ OK ] 4.43 sec.
2025-09-09 14:44:20 00974_fix_join_on: [ OK ] 0.82 sec.
2025-09-09 14:44:20 02567_native_type_conversions: [ OK ] 1.42 sec.
2025-09-09 14:44:20 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.32 sec.
2025-09-09 14:44:21 01101_literal_column_clash: [ OK ] 0.47 sec.
2025-09-09 14:44:21 01460_line_as_string_format: [ OK ] 7.94 sec.
2025-09-09 14:44:21 02494_parser_string_binary_literal: [ OK ] 0.37 sec.
2025-09-09 14:44:22 00872_t64_bit_codec: [ OK ] 1.17 sec.
2025-09-09 14:44:22 02017_columns_with_dot: [ OK ] 0.37 sec.
2025-09-09 14:44:22 01592_toUnixTimestamp_Date: [ OK ] 0.37 sec.
2025-09-09 14:44:23 01607_arrays_as_nested_csv: [ OK ] 1.97 sec.
2025-09-09 14:44:23 02293_grouping_function_group_by: [ OK ] 0.72 sec.
2025-09-09 14:44:23 00284_external_aggregation_2: [ OK ] 5.28 sec.
2025-09-09 14:44:23 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 1.47 sec.
2025-09-09 14:44:23 02713_sequence_match_serialization_fix: [ OK ] 0.37 sec.
2025-09-09 14:44:23 00738_nested_merge_multidimensional_array: [ OK ] 0.52 sec.
2025-09-09 14:44:23 02364_window_case: [ OK ] 0.32 sec.
2025-09-09 14:44:24 01492_format_readable_quantity: [ OK ] 0.32 sec.
2025-09-09 14:44:24 01051_window_view_parser_hop: [ OK ] 0.57 sec.
2025-09-09 14:44:24 00818_alias_bug_4110: [ OK ] 0.52 sec.
2025-09-09 14:44:24 01865_aggregator_overflow_row: [ OK ] 0.67 sec.
2025-09-09 14:44:24 01450_set_null_const: [ OK ] 0.32 sec.
2025-09-09 14:44:25 01926_bin_unbin: [ OK ] 0.47 sec.
2025-09-09 14:44:25 01651_group_uniq_array_enum: [ OK ] 0.42 sec.
2025-09-09 14:44:25 02421_new_type_json_async_insert: [ OK ] 2.87 sec.
2025-09-09 14:44:25 02246_clickhouse_local_drop_database: [ OK ] 1.07 sec.
2025-09-09 14:44:26 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.27 sec.
2025-09-09 14:44:26 01000_unneeded_substitutions_client: [ OK ] 0.92 sec.
2025-09-09 14:44:26 00405_output_format_pretty_color: [ OK ] 0.57 sec.
2025-09-09 14:44:26 01017_bithamming_distance: [ OK ] 0.47 sec.
2025-09-09 14:44:26 02676_trailing_commas: [ OK ] 0.37 sec.
2025-09-09 14:44:27 00394_new_nested_column_keeps_offsets: [ OK ] 0.37 sec.
2025-09-09 14:44:27 02499_escaped_quote_schema_inference: [ OK ] 0.37 sec.
2025-09-09 14:44:27 03211_nested_json_merges: [ OK ] 29.14 sec.
2025-09-09 14:44:27 02932_kill_query_sleep: [ OK ] 2.78 sec.
2025-09-09 14:44:27 00552_logical_functions_uint8_as_bool: [ OK ] 0.32 sec.
2025-09-09 14:44:27 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.32 sec.
2025-09-09 14:44:27 00712_prewhere_with_final: [ OK ] 0.37 sec.
2025-09-09 14:44:27 00296_url_parameters: [ OK ] 0.52 sec.
2025-09-09 14:44:28 03043_group_array_result_is_expected: [ OK ] 0.37 sec.
2025-09-09 14:44:28 00732_base64_functions: [ OK ] 0.42 sec.
2025-09-09 14:44:28 00825_protobuf_format_nested_in_nested: [ OK ] 2.07 sec.
2025-09-09 14:44:28 02136_scalar_progress: [ OK ] 0.62 sec.
2025-09-09 14:44:28 02375_scalar_lc_cte: [ OK ] 0.27 sec.
2025-09-09 14:44:28 01284_view_and_extremes_bug: [ OK ] 0.32 sec.
2025-09-09 14:44:28 00972_geohashesInBox: [ OK ] 0.87 sec.
2025-09-09 14:44:28 01068_parens: [ OK ] 0.32 sec.
2025-09-09 14:44:29 00725_memory_tracking: [ OK ] 0.72 sec.
2025-09-09 14:44:29 00098_7_union_all: [ OK ] 0.32 sec.
2025-09-09 14:44:29 00980_merge_alter_settings: [ OK ] 0.57 sec.
2025-09-09 14:44:29 01585_fuzz_bits_with_bugfix: [ OK ] 0.32 sec.
2025-09-09 14:44:29 02426_orc_bug: [ OK ] 0.87 sec.
2025-09-09 14:44:30 01656_ipv4_bad_formatting: [ OK ] 0.27 sec.
2025-09-09 14:44:30 02234_position_case_insensitive_utf8: [ OK ] 0.32 sec.
2025-09-09 14:44:30 02815_no_throw_in_simple_queries: [ FAIL ] 1.82 sec.
2025-09-09 14:44:30 Reason: return code: 1
2025-09-09 14:44:30 send: spawn id exp3 not open
2025-09-09 14:44:30 while executing
2025-09-09 14:44:30 "send -- "exit\r""
2025-09-09 14:44:30 , result:
2025-09-09 14:44:30
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30
2025-09-09 14:44:30 stdout:
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30 Failed
2025-09-09 14:44:30
2025-09-09 14:44:30
2025-09-09 14:44:30 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 440848 --group_by_two_level_threshold_bytes 1 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 11420604 --max_read_buffer_size 615897 --prefer_localhost_replica 0 --max_block_size 51547 --max_joined_block_size_rows 89055 --max_threads 1 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 79 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 42016134 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method pread --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 5 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 6158669133 --max_bytes_before_remerge_sort 733749748 --min_compress_block_size 737604 --max_compress_block_size 2172476 --merge_tree_compact_parts_min_granules_to_multibuffer_read 25 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 7446953 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone America/Mazatlan --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.95 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 1 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 1
2025-09-09 14:44:30
2025-09-09 14:44:30 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.5960570823936479 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 58896 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 20345261 --merge_max_block_size 16144 --index_granularity 28256 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 81261 --primary_key_compress_block_size 18780 --replace_long_file_name_to_hash 1 --max_file_name_length 0 --min_bytes_for_full_part_storage 392534242 --compact_parts_max_bytes_to_buffer 46752755 --compact_parts_max_granules_to_buffer 242 --compact_parts_merge_max_bytes_to_prefetch_part 21984341 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 75 --old_parts_lifetime 480
2025-09-09 14:44:30
2025-09-09 14:44:30 Database: test_qiui6thi
2025-09-09 14:44:30 02474_fix_function_parser_bug: [ OK ] 0.42 sec.
2025-09-09 14:44:30 03258_old_analyzer_const_expr_bug: [ OK ] 0.42 sec.
2025-09-09 14:44:30 02995_index_9: [ SKIPPED ] 0.00 sec.
2025-09-09 14:44:30 Reason: not running for current build
2025-09-09 14:44:30 02458_key_condition_not_like_prefix: [ OK ] 0.47 sec.
2025-09-09 14:44:30 02267_file_globs_schema_inference: [ OK ] 2.78 sec.
2025-09-09 14:44:30 01415_sticking_mutations: [ OK ] 19.07 sec.
2025-09-09 14:44:31 01388_clear_all_columns: [ OK ] 0.47 sec.
2025-09-09 14:44:31 02882_formatQuery: [ OK ] 0.52 sec.
2025-09-09 14:44:31 02842_suggest_http_page_in_error_message: [ OK ] 0.57 sec.
2025-09-09 14:44:31 01155_old_mutation_parts_to_do: [ OK ] 12.95 sec.
2025-09-09 14:44:31 01710_query_log_with_projection_info: [ OK ] 0.77 sec.
2025-09-09 14:44:31 02354_vector_search_default_granularity: [ OK ] 0.38 sec.
2025-09-09 14:44:31 02354_tuple_element_with_default: [ OK ] 0.32 sec.
2025-09-09 14:44:31 01032_cityHash64_for_UUID: [ OK ] 0.42 sec.
2025-09-09 14:44:32 02269_to_start_of_interval_overflow: [ OK ] 0.42 sec.
2025-09-09 14:44:32 03164_early_constant_folding_analyzer: [ OK ] 0.52 sec.
2025-09-09 14:44:32 02999_scalar_subqueries_bug_1: [ OK ] 0.47 sec.
2025-09-09 14:44:32 01096_zeros: [ OK ] 0.42 sec.
2025-09-09 14:44:32 03144_alter_column_and_read: [ OK ] 0.32 sec.
2025-09-09 14:44:33 00594_alias_in_distributed: [ OK ] 0.77 sec.
2025-09-09 14:44:33 03156_default_multiquery_split: [ OK ] 1.17 sec.
2025-09-09 14:44:33 01187_set_profile_as_setting: [ OK ] 1.07 sec.
2025-09-09 14:44:33 01273_h3EdgeAngle_range_check: [ OK ] 0.37 sec.
2025-09-09 14:44:33 00355_array_of_non_const_convertible_types: [ OK ] 0.37 sec.
2025-09-09 14:44:33 02337_check_translate_qualified_names_matcher: [ OK ] 0.37 sec.
2025-09-09 14:44:34 01051_same_name_alias_with_joins: [ OK ] 0.37 sec.
2025-09-09 14:44:34 00492_drop_temporary_table: [ OK ] 0.37 sec.
2025-09-09 14:44:34 00910_client_window_size_detection: [ OK ] 1.22 sec.
2025-09-09 14:44:34 00939_limit_by_offset: [ OK ] 0.42 sec.
2025-09-09 14:44:35 00725_join_on_bug_2: [ OK ] 0.47 sec.
2025-09-09 14:44:35 01188_attach_table_from_path: [ OK ] 0.63 sec.
2025-09-09 14:44:35 01116_asof_join_dolbyzerr: [ OK ] 0.47 sec.
2025-09-09 14:44:36 03155_test_move_to_prewhere: [ OK ] 2.08 sec.
2025-09-09 14:44:36 02022_storage_filelog_one_file: [ OK ] 3.98 sec.
2025-09-09 14:44:36 01458_named_tuple_millin: [ OK ] 0.42 sec.
2025-09-09 14:44:36 02539_generate_random_ip: [ OK ] 0.37 sec.
2025-09-09 14:44:36 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.32 sec.
2025-09-09 14:44:36 01264_nested_baloo_bear: [ OK ] 0.42 sec.
2025-09-09 14:44:37 02994_sanity_check_settings: [ OK ] 0.47 sec.
2025-09-09 14:44:37 01527_materialized_view_stack_overflow: [ OK ] 1.47 sec.
2025-09-09 14:44:37 01509_parallel_quorum_and_merge_long: [ OK ] 6.89 sec.
2025-09-09 14:44:37 03143_parallel_replicas_mat_view_bug: [ OK ] 0.42 sec.
2025-09-09 14:44:38 03036_dynamic_read_subcolumns_memory: [ OK ] 1.62 sec.
2025-09-09 14:44:38 03062_analyzer_join_engine_missing_column: [ OK ] 0.37 sec.
2025-09-09 14:44:38 01798_uniq_theta_sketch: [ OK ] 1.02 sec.
2025-09-09 14:44:38 01493_table_function_null: [ OK ] 0.32 sec.
2025-09-09 14:44:38 02013_bloom_filter_hasAll: [ OK ] 0.57 sec.
2025-09-09 14:44:39 02231_hierarchical_dictionaries_constant: [ OK ] 0.47 sec.
2025-09-09 14:44:39 02565_analyzer_limit_settings: [ OK ] 0.47 sec.
2025-09-09 14:44:39 02004_max_hyperscan_regex_length: [ SKIPPED ] 0.00 sec.
2025-09-09 14:44:39 Reason: not running for current build
2025-09-09 14:44:39 01079_bad_alters_zookeeper_long: [ OK ] 7.74 sec.
2025-09-09 14:44:39 01328_bad_peephole_optimization: [ OK ] 0.32 sec.
2025-09-09 14:44:39 03040_recursive_cte_postgres_6: [ OK ] 0.67 sec.
2025-09-09 14:44:40 02864_statistics_predicates: [ OK ] 1.57 sec.
2025-09-09 14:44:40 00370_duplicate_columns_in_subqueries: [ OK ] 0.37 sec.
2025-09-09 14:44:40 01551_mergetree_read_in_order_spread: [ OK ] 0.32 sec.
2025-09-09 14:44:40 02311_range_hashed_dictionary_range_cast: [ OK ] 0.37 sec.
2025-09-09 14:44:40 00746_sql_fuzzy: [ OK ] 20.32 sec.
2025-09-09 14:44:40 01073_crlf_end_of_line: [ OK ] 0.37 sec.
2025-09-09 14:44:40 02381_parseDateTime64BestEffortUS: [ OK ] 0.32 sec.
2025-09-09 14:44:41 00445_join_nullable_keys: [ OK ] 0.37 sec.
2025-09-09 14:44:41 02969_auto_format_detection: [ OK ] 12.00 sec.
2025-09-09 14:44:41 02024_join_on_or_long: [ OK ] 1.22 sec.
2025-09-09 14:44:41 02192_comment_error: [ OK ] 1.67 sec.
2025-09-09 14:44:41 02497_if_transform_strings_to_enum: [ OK ] 0.57 sec.
2025-09-09 14:44:41 02306_window_move_row_number_fix: [ OK ] 0.27 sec.
2025-09-09 14:44:42 03033_final_undefined_last_mark: [ OK ] 0.17 sec.
2025-09-09 14:44:42 02423_insert_stats_behaviour: [ OK ] 4.23 sec.
2025-09-09 14:44:42 03031_tuple_elimination_analyzer: [ OK ] 0.32 sec.
2025-09-09 14:44:42 01280_unicode_whitespaces_lexer: [ OK ] 0.32 sec.
2025-09-09 14:44:42 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 3.13 sec.
2025-09-09 14:44:43 00831_quantile_weighted_parameter_check: [ OK ] 0.37 sec.
2025-09-09 14:44:43 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 1.22 sec.
2025-09-09 14:44:43 02480_tets_show_full: [ OK ] 1.17 sec.
2025-09-09 14:44:43 03002_modify_query_cte: [ OK ] 0.27 sec.
2025-09-09 14:44:43 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 2.78 sec.
2025-09-09 14:44:43 00757_enum_defaults_const_analyzer: [ OK ] 0.32 sec.
2025-09-09 14:44:43 01622_constraints_where_optimization: [ OK ] 0.37 sec.
2025-09-09 14:44:43 01804_uniq_up_to_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:44:43 02243_make_date32: [ OK ] 0.62 sec.
2025-09-09 14:44:44 00623_in_partition_key: [ OK ] 0.62 sec.
2025-09-09 14:44:44 01518_nullable_aggregate_states2: [ OK ] 1.98 sec.
2025-09-09 14:44:44 00135_duplicate_group_by_keys_segfault: [ OK ] 0.12 sec.
2025-09-09 14:44:44 02896_cyclic_aliases_crash: [ OK ] 0.42 sec.
2025-09-09 14:44:44 02721_parquet_field_not_found: [ OK ] 0.82 sec.
2025-09-09 14:44:44 00563_shard_insert_into_remote: [ OK ] 0.42 sec.
2025-09-09 14:44:45 01134_max_rows_to_group_by: [ OK ] 0.42 sec.
2025-09-09 14:44:45 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.52 sec.
2025-09-09 14:44:45 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.32 sec.
2025-09-09 14:44:45 01926_union_all_schmak: [ OK ] 0.37 sec.
2025-09-09 14:44:46 00897_flatten: [ OK ] 0.37 sec.
2025-09-09 14:44:46 01010_partial_merge_join_const_and_lc: [ OK ] 0.47 sec.
2025-09-09 14:44:46 00752_low_cardinality_lambda_argument: [ OK ] 0.37 sec.
2025-09-09 14:44:46 02494_array_function_range: [ OK ] 0.32 sec.
2025-09-09 14:44:47 01358_mutation_delete_null_rows: [ OK ] 0.42 sec.
2025-09-09 14:44:47 02500_remove_redundant_distinct_analyzer: [ OK ] 11.66 sec.
2025-09-09 14:44:47 01655_test_isnull_mysql_dialect: [ OK ] 0.32 sec.
2025-09-09 14:44:47 02133_distributed_queries_formatting: [ OK ] 0.32 sec.
2025-09-09 14:44:47 01326_build_id: [ OK ] 0.32 sec.
2025-09-09 14:44:47 01040_distributed_background_insert_batch_inserts: [ OK ] 0.52 sec.
2025-09-09 14:44:48 02456_keeper_retries_during_insert: [ OK ] 1.67 sec.
2025-09-09 14:44:48 02572_max_intersections: [ OK ] 0.32 sec.
2025-09-09 14:44:48 01796_Log_rwlock_ub: [ OK ] 0.32 sec.
2025-09-09 14:44:48 00116_storage_set: [ OK ] 0.42 sec.
2025-09-09 14:44:48 02971_limit_by_distributed: [ OK ] 0.42 sec.
2025-09-09 14:44:48 03199_merge_filters_bug: [ OK ] 0.47 sec.
2025-09-09 14:44:48 02994_inconsistent_formatting: [ OK ] 0.37 sec.
2025-09-09 14:44:48 02254_projection_broken_part: [ OK ] 4.88 sec.
2025-09-09 14:44:49 00779_all_right_join_max_block_size: [ OK ] 0.32 sec.
2025-09-09 14:44:49 02002_row_level_filter_bug: [ OK ] 5.53 sec.
2025-09-09 14:44:49 03031_filter_float64_logical_error: [ OK ] 0.37 sec.
2025-09-09 14:44:49 01560_crash_in_agg_empty_arglist: [ OK ] 0.57 sec.
2025-09-09 14:44:49 02125_fix_storage_filelog: [ OK ] 0.32 sec.
2025-09-09 14:44:49 01866_bit_positions_to_array: [ OK ] 0.47 sec.
2025-09-09 14:44:49 00059_shard_global_in: [ OK ] 0.37 sec.
2025-09-09 14:44:49 02998_analyzer_secret_args_tree_node: [ OK ] 0.32 sec.
2025-09-09 14:44:49 01118_is_constant: [ OK ] 0.37 sec.
2025-09-09 14:44:49 00811_garbage: [ OK ] 0.32 sec.
2025-09-09 14:44:49 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 0.52 sec.
2025-09-09 14:44:50 01380_nullable_state: [ OK ] 0.62 sec.
2025-09-09 14:44:50 01686_rocksdb: [ OK ] 0.57 sec.
2025-09-09 14:44:50 00760_insert_json_with_defaults: [ OK ] 0.52 sec.
2025-09-09 14:44:50 01062_pm_all_join_with_block_continuation: [ OK ] 8.04 sec.
2025-09-09 14:44:50 02813_any_value: [ OK ] 0.37 sec.
2025-09-09 14:44:50 00754_alter_modify_column_partitions: [ OK ] 0.52 sec.
2025-09-09 14:44:50 01674_clickhouse_client_query_param_cte: [ OK ] 0.87 sec.
2025-09-09 14:44:50 02842_filesystem_cache_validate_path: [ OK ] 0.37 sec.
2025-09-09 14:44:50 00449_filter_array_nullable_tuple: [ OK ] 0.32 sec.
2025-09-09 14:44:50 00618_nullable_in: [ OK ] 0.32 sec.
2025-09-09 14:44:50 03129_cte_with_final: [ OK ] 0.32 sec.
2025-09-09 14:44:50 00666_uniq_complex_types: [ OK ] 0.47 sec.
2025-09-09 14:44:51 02715_or_null: [ OK ] 0.32 sec.
2025-09-09 14:44:51 02030_function_mapContainsKeyLike: [ OK ] 0.42 sec.
2025-09-09 14:44:51 03261_sort_cursor_crash: [ OK ] 0.42 sec.
2025-09-09 14:44:51 01513_defaults_on_defaults_no_column: [ OK ] 0.32 sec.
2025-09-09 14:44:51 00974_low_cardinality_cast: [ OK ] 0.42 sec.
2025-09-09 14:44:51 02003_compress_bz2: [ OK ] 1.17 sec.
2025-09-09 14:44:52 03206_no_exceptions_clickhouse_local: [ FAIL ] 0.67 sec.
2025-09-09 14:44:52 Reason: return code: 134, result:
2025-09-09 14:44:52
2025-09-09 14:44:52
2025-09-09 14:44:52
2025-09-09 14:44:52 stdout:
2025-09-09 14:44:52
2025-09-09 14:44:52
2025-09-09 14:44:52 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 15830858 --max_read_buffer_size 996073 --prefer_localhost_replica 1 --max_block_size 65522 --max_joined_block_size_rows 15821 --max_threads 2 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 44 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 48706864 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 2073937208 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method io_uring --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 16Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 0 --compile_sort_description 1 --merge_tree_coarse_index_granularity 6 --optimize_distinct_in_order 1 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 472419922 --min_compress_block_size 399038 --max_compress_block_size 881305 --merge_tree_compact_parts_min_granules_to_multibuffer_read 86 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 4308208 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 3 --session_timezone America/Mazatlan --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.92 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 1 --max_parsing_threads 10 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 0
2025-09-09 14:44:52
2025-09-09 14:44:52 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 7285486790 --index_granularity_bytes 11926047 --merge_max_block_size 13125 --index_granularity 47825 --min_bytes_for_wide_part 958568044 --marks_compress_block_size 63916 --primary_key_compress_block_size 69596 --replace_long_file_name_to_hash 1 --max_file_name_length 0 --min_bytes_for_full_part_storage 504049153 --compact_parts_max_bytes_to_buffer 222168688 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 536408 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 27 --old_parts_lifetime 10
2025-09-09 14:44:52
2025-09-09 14:44:52 Database: test_vpuihec0
2025-09-09 14:44:52 01881_join_on_conditions_hash: [ OK ] 1.22 sec.
2025-09-09 14:44:52 02999_ulid_short_circuit: [ OK ] 0.32 sec.
2025-09-09 14:44:52 02981_vertical_merges_memory_usage: [ OK ] 1.52 sec.
2025-09-09 14:44:52 02475_precise_decimal_arithmetics: [ OK ] 0.52 sec.
2025-09-09 14:44:52 01037_zookeeper_check_table_empty_pk: [ OK ] 0.42 sec.
2025-09-09 14:44:52 02497_source_part_is_intact_when_mutation: [ OK ] 0.42 sec.
2025-09-09 14:44:52 02136_kill_scalar_queries: [ OK ] 1.27 sec.
2025-09-09 14:44:53 02124_insert_deduplication_token: [ OK ] 0.42 sec.
2025-09-09 14:44:53 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.32 sec.
2025-09-09 14:44:53 01942_dateTimeToSnowflake: [ OK ] 0.52 sec.
2025-09-09 14:44:53 02457_tuple_of_intervals: [ OK ] 0.57 sec.
2025-09-09 14:44:54 02013_json_function_null_column: [ OK ] 0.57 sec.
2025-09-09 14:44:54 02290_client_insert_cancel: [ OK ] 1.32 sec.
2025-09-09 14:44:54 00172_constexprs_in_set: [ OK ] 0.37 sec.
2025-09-09 14:44:55 01147_partial_merge_full_join: [ OK ] 1.02 sec.
2025-09-09 14:44:55 02697_stop_reading_on_first_cancel: [ OK ] 1.77 sec.
2025-09-09 14:44:55 00104_totals_having_mode: [ OK ] 0.52 sec.
2025-09-09 14:44:55 01620_fix_simple_state_arg_type: [ OK ] 0.37 sec.
2025-09-09 14:44:55 02895_peak_memory_usage_http_headers_regression: [ OK ] 0.87 sec.
2025-09-09 14:44:56 01075_allowed_client_hosts: [ OK ] 0.37 sec.
2025-09-09 14:44:56 01825_new_type_json_insert_select: [ OK ] 0.72 sec.
2025-09-09 14:44:56 02381_analyzer_join_final: [ OK ] 0.47 sec.
2025-09-09 14:44:56 01532_tuple_with_name_type: [ OK ] 0.42 sec.
2025-09-09 14:44:57 01050_group_array_sample: [ OK ] 0.42 sec.
2025-09-09 14:44:57 02457_csv_parse_date_out_of_range: [ OK ] 1.92 sec.
2025-09-09 14:44:57 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec.
2025-09-09 14:44:57 Reason: not running for current build
2025-09-09 14:44:58 02372_now_in_block: [ OK ] 1.32 sec.
2025-09-09 14:44:58 01013_hex_decimal: [ OK ] 0.37 sec.
2025-09-09 14:44:58 02155_nested_lc_defalut_bug: [ OK ] 0.32 sec.
2025-09-09 14:44:58 02899_indexing_by_space_filling_curves: [ OK ] 0.62 sec.
2025-09-09 14:44:58 00740_database_in_nested_view: [ OK ] 0.37 sec.
2025-09-09 14:44:59 02686_bson3: [ OK ] 0.32 sec.
2025-09-09 14:44:59 01535_decimal_round_scale_overflow_check: [ OK ] 0.32 sec.
2025-09-09 14:44:59 00277_array_filter: [ OK ] 0.32 sec.
2025-09-09 14:44:59 02302_clash_const_aggegate_join: [ OK ] 0.42 sec.
2025-09-09 14:44:59 01457_int256_hashing: [ OK ] 0.42 sec.
2025-09-09 14:45:00 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.42 sec.
2025-09-09 14:45:00 00278_insert_already_sorted: [ OK ] 0.57 sec.
2025-09-09 14:45:00 02963_single_value_destructor: [ OK ] 0.52 sec.
2025-09-09 14:45:00 02276_full_sort_join_unsupported: [ OK ] 0.53 sec.
2025-09-09 14:45:01 00500_point_in_polygon: [ OK ] 0.52 sec.
2025-09-09 14:45:01 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.37 sec.
2025-09-09 14:45:01 02784_parallel_replicas_automatic_decision: [ OK ] 8.39 sec.
2025-09-09 14:45:01 01825_new_type_json_9: [ OK ] 0.42 sec.
2025-09-09 14:45:01 02207_ttl_move_if_exists: [ OK ] 0.27 sec.
2025-09-09 14:45:01 00389_concat_operator: [ OK ] 0.32 sec.
2025-09-09 14:45:01 01825_new_type_json_distributed: [ OK ] 0.37 sec.
2025-09-09 14:45:02 00628_in_lambda_on_merge_table_bug: [ OK ] 0.42 sec.
2025-09-09 14:45:02 01085_simdjson_uint64: [ OK ] 0.37 sec.
2025-09-09 14:45:02 00937_test_use_header_csv: [ OK ] 5.13 sec.
2025-09-09 14:45:02 01817_storage_buffer_parameters: [ OK ] 0.32 sec.
2025-09-09 14:45:02 02586_generate_random_structure: [ OK ] 0.47 sec.
2025-09-09 14:45:02 00358_from_string_complex_types: [ OK ] 0.32 sec.
2025-09-09 14:45:02 01476_right_full_join_switch: [ OK ] 0.47 sec.
2025-09-09 14:45:03 00098_g_union_all: [ OK ] 0.37 sec.
2025-09-09 14:45:03 00177_inserts_through_http_parts: [ OK ] 0.67 sec.
2025-09-09 14:45:03 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.37 sec.
2025-09-09 14:45:03 01532_clickhouse_local_tmp_folder: [ OK ] 0.67 sec.
2025-09-09 14:45:03 03013_position_const_start_pos: [ OK ] 0.32 sec.
2025-09-09 14:45:03 02481_default_value_used_in_row_level_filter: [ OK ] 0.42 sec.
2025-09-09 14:45:03 02232_partition_pruner_mixed_constant_type: [ OK ] 0.37 sec.
2025-09-09 14:45:04 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.42 sec.
2025-09-09 14:45:04 00835_if_generic_case: [ OK ] 0.47 sec.
2025-09-09 14:45:04 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.72 sec.
2025-09-09 14:45:04 03159_dynamic_type_all_types: [ OK ] 0.42 sec.
2025-09-09 14:45:04 00275_shard_quantiles_weighted: [ OK ] 0.52 sec.
2025-09-09 14:45:05 02269_bool_map_sync_after_error: [ OK ] 3.73 sec.
2025-09-09 14:45:05 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec.
2025-09-09 14:45:05 Reason: not running for current build
2025-09-09 14:45:05 03093_bug_gcd_codec: [ OK ] 0.47 sec.
2025-09-09 14:45:05 02974_analyzer_array_join_subcolumn: [ OK ] 0.42 sec.
2025-09-09 14:45:05 03039_dynamic_aggregating_merge_tree: [ OK ] 14.75 sec.
2025-09-09 14:45:06 02382_join_and_filtering_set: [ OK ] 0.57 sec.
2025-09-09 14:45:06 02802_clickhouse_disks_s3_copy: [ OK ] 1.37 sec.
2025-09-09 14:45:06 01043_h3_edge_length_m: [ OK ] 0.37 sec.
2025-09-09 14:45:06 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 0.57 sec.
2025-09-09 14:45:06 00725_join_on_bug_4: [ OK ] 0.47 sec.
2025-09-09 14:45:06 03290_limit_by_segv: [ OK ] 0.32 sec.
2025-09-09 14:45:07 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.42 sec.
2025-09-09 14:45:07 02479_if_with_null_and_cullable_const: [ OK ] 0.37 sec.
2025-09-09 14:45:08 02428_delete_with_settings: [ OK ] 0.57 sec.
2025-09-09 14:45:08 01825_type_json_7: [ OK ] 2.37 sec.
2025-09-09 14:45:08 02908_Npy_files_caching: [ OK ] 1.57 sec.
2025-09-09 14:45:09 01196_max_parser_depth: [ OK ] 1.12 sec.
2025-09-09 14:45:09 00523_aggregate_functions_in_group_array: [ OK ] 0.32 sec.
2025-09-09 14:45:09 01942_untuple_transformers_msan: [ OK ] 0.27 sec.
2025-09-09 14:45:09 02844_max_backup_bandwidth_s3: [ OK ] 28.74 sec.
2025-09-09 14:45:10 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.27 sec.
2025-09-09 14:45:10 01013_hex_float: [ OK ] 0.32 sec.
2025-09-09 14:45:10 01273_arrow_stream: [ OK ] 18.77 sec.
2025-09-09 14:45:10 02426_pod_array_overflow_3: [ OK ] 0.37 sec.
2025-09-09 14:45:10 00846_join_using_tuple_crash: [ OK ] 0.32 sec.
2025-09-09 14:45:10 02008_materialize_column: [ OK ] 0.52 sec.
2025-09-09 14:45:11 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.52 sec.
2025-09-09 14:45:11 02982_comments_in_system_tables: [ OK ] 0.97 sec.
2025-09-09 14:45:11 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.37 sec.
2025-09-09 14:45:11 03008_deduplication_insert_into_partitioned_table: [ OK ] 0.87 sec.
2025-09-09 14:45:11 01652_ttl_old_syntax: [ OK ] 0.32 sec.
2025-09-09 14:45:11 01020_function_char: [ OK ] 0.37 sec.
2025-09-09 14:45:12 01087_index_set_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:45:12 03151_dynamic_type_scale_max_types: [ OK ] 0.67 sec.
2025-09-09 14:45:12 00341_squashing_insert_select2: [ OK ] 0.52 sec.
2025-09-09 14:45:12 03208_uniq_with_empty_tuple: [ OK ] 0.37 sec.
2025-09-09 14:45:12 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 4.23 sec.
2025-09-09 14:45:12 02162_array_first_last_index: [ OK ] 0.37 sec.
2025-09-09 14:45:12 02414_all_new_table_functions_must_be_documented: [ OK ] 0.27 sec.
2025-09-09 14:45:12 00205_scalar_subqueries: [ OK ] 0.42 sec.
2025-09-09 14:45:13 01234_to_string_monotonic: [ OK ] 0.52 sec.
2025-09-09 14:45:13 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.32 sec.
2025-09-09 14:45:13 02114_bool_type: [ OK ] 0.37 sec.
2025-09-09 14:45:13 01710_projection_drop_if_exists: [ OK ] 0.37 sec.
2025-09-09 14:45:13 02515_tuple_lambda_parsing: [ OK ] 0.27 sec.
2025-09-09 14:45:13 03069_analyzer_with_alias_in_array_join: [ OK ] 0.32 sec.
2025-09-09 14:45:13 00853_join_with_nulls_crash: [ OK ] 0.42 sec.
2025-09-09 14:45:13 03210_empty_tuple_lhs_of_in: [ OK ] 0.32 sec.
2025-09-09 14:45:13 02205_map_populate_series_non_const: [ OK ] 0.72 sec.
2025-09-09 14:45:14 01634_summap_nullable: [ OK ] 0.37 sec.
2025-09-09 14:45:14 02353_compression_level: [ OK ] 7.99 sec.
2025-09-09 14:45:14 01891_partition_hash_no_long_int: [ OK ] 0.37 sec.
2025-09-09 14:45:14 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.37 sec.
2025-09-09 14:45:14 02374_analyzer_array_join: [ OK ] 0.67 sec.
2025-09-09 14:45:14 01626_cnf_test: [ OK ] 0.37 sec.
2025-09-09 14:45:14 01710_normal_projection_join_plan_fix: [ OK ] 0.42 sec.
2025-09-09 14:45:14 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.37 sec.
2025-09-09 14:45:14 00996_neighbor: [ OK ] 0.47 sec.
2025-09-09 14:45:14 02126_url_auth: [ OK ] 1.17 sec.
2025-09-09 14:45:15 02428_index_analysis_with_null_literal: [ OK ] 0.72 sec.
2025-09-09 14:45:15 01881_join_on_conditions_merge: [ OK ] 1.07 sec.
2025-09-09 14:45:15 02100_multiple_hosts_command_line_set_ssl: [ OK ] 31.95 sec.
2025-09-09 14:45:15 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.32 sec.
2025-09-09 14:45:16 00825_protobuf_format_persons: [ OK ] 7.54 sec.
2025-09-09 14:45:16 02207_s3_content_type: [ OK ] 1.52 sec.
2025-09-09 14:45:16 02922_respect_nulls_extensive: [ OK ] 0.62 sec.
2025-09-09 14:45:16 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 2.12 sec.
2025-09-09 14:45:17 02129_add_column_add_ttl: [ OK ] 0.47 sec.
2025-09-09 14:45:17 00267_tuple_array_access_operators_priority: [ OK ] 0.32 sec.
2025-09-09 14:45:17 02735_system_zookeeper_connection: [ OK ] 0.37 sec.
2025-09-09 14:45:18 02311_system_zookeeper_insert: [ OK ] 0.72 sec.
2025-09-09 14:45:18 01019_array_fill: [ OK ] 0.37 sec.
2025-09-09 14:45:18 00805_round_down: [ OK ] 0.42 sec.
2025-09-09 14:45:19 03214_backup_and_clear_old_temporary_directories: [ OK ] 3.23 sec.
2025-09-09 14:45:19 02860_distributed_flush_on_detach: [ OK ] 0.42 sec.
2025-09-09 14:45:19 01076_predicate_optimizer_with_view: [ OK ] 0.43 sec.
2025-09-09 14:45:20 02971_analyzer_remote_id: [ OK ] 0.97 sec.
2025-09-09 14:45:21 02228_merge_tree_insert_memory_usage: [ OK ] 1.63 sec.
2025-09-09 14:45:21 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.37 sec.
2025-09-09 14:45:21 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 4.39 sec.
2025-09-09 14:45:21 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.62 sec.
2025-09-09 14:45:21 01272_suspicious_codecs: [ OK ] 0.77 sec.
2025-09-09 14:45:22 01471_top_k_range_check: [ OK ] 0.32 sec.
2025-09-09 14:45:22 02981_variant_type_function: [ OK ] 0.37 sec.
2025-09-09 14:45:22 01666_gcd_ubsan: [ OK ] 0.47 sec.
2025-09-09 14:45:22 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.37 sec.
2025-09-09 14:45:22 01558_transform_null_in: [ OK ] 0.42 sec.
2025-09-09 14:45:22 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.52 sec.
2025-09-09 14:45:22 00981_no_virtual_columns: [ OK ] 0.37 sec.
2025-09-09 14:45:23 01020_having_without_group_by: [ OK ] 0.32 sec.
2025-09-09 14:45:23 03003_prql_panic: [ OK ] 0.97 sec.
2025-09-09 14:45:24 01271_show_privileges: [ OK ] 0.33 sec.
2025-09-09 14:45:24 00909_kill_not_initialized_query: [ OK ] 8.34 sec.
2025-09-09 14:45:24 01939_network_receive_bytes_metrics: [ OK ] 1.87 sec.
2025-09-09 14:45:24 02895_npy_format: [ OK ] 8.39 sec.
2025-09-09 14:45:24 01781_token_extractor_buffer_overflow: [ OK ] 0.47 sec.
2025-09-09 14:45:24 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.37 sec.
2025-09-09 14:45:24 03066_analyzer_global_with_statement: [ OK ] 0.32 sec.
2025-09-09 14:45:25 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.37 sec.
2025-09-09 14:45:25 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.42 sec.
2025-09-09 14:45:25 00009_array_join_subquery: [ OK ] 0.32 sec.
2025-09-09 14:45:25 02332_dist_insert_send_logs_level: [ OK ] 1.12 sec.
2025-09-09 14:45:26 01917_prewhere_column_type: [ OK ] 0.42 sec.
2025-09-09 14:45:26 01825_new_type_json_nbagames: [ OK ] 11.20 sec.
2025-09-09 14:45:26 02661_read_from_archive_tzst: [ OK ] 10.45 sec.
2025-09-09 14:45:26 01099_operators_date_and_timestamp: [ OK ] 0.82 sec.
2025-09-09 14:45:26 03065_analyzer_cross_join_and_array_join: [ OK ] 0.27 sec.
2025-09-09 14:45:26 03224_json_merges_new_type_in_shared_data: [ OK ] 0.47 sec.
2025-09-09 14:45:26 03203_variant_convert_field_to_type_bug: [ OK ] 0.32 sec.
2025-09-09 14:45:26 02221_parallel_replicas_bug: [ OK ] 1.77 sec.
2025-09-09 14:45:26 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.33 sec.
2025-09-09 14:45:27 00686_client_exit_code: [ OK ] 0.82 sec.
2025-09-09 14:45:27 00552_or_nullable: [ OK ] 0.37 sec.
2025-09-09 14:45:27 02203_shebang: [ OK ] 0.77 sec.
2025-09-09 14:45:27 00164_not_chain: [ OK ] 0.47 sec.
2025-09-09 14:45:27 02012_zookeeper_changed_enum_type: [ OK ] 0.42 sec.
2025-09-09 14:45:28 02921_fuzzbits_with_array_join: [ OK ] 0.37 sec.
2025-09-09 14:45:28 01458_count_digits: [ OK ] 0.42 sec.
2025-09-09 14:45:28 02010_array_index_bad_cast: [ OK ] 0.32 sec.
2025-09-09 14:45:28 02178_column_function_insert_from: [ OK ] 0.32 sec.
2025-09-09 14:45:28 03008_index_small: [ OK ] 0.37 sec.
2025-09-09 14:45:28 01353_topk_enum: [ OK ] 0.32 sec.
2025-09-09 14:45:29 03205_system_sync_replica_format: [ OK ] 0.32 sec.
2025-09-09 14:45:29 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 4.28 sec.
2025-09-09 14:45:29 02469_interval_msan: [ OK ] 0.42 sec.
2025-09-09 14:45:29 00908_long_http_insert: [ OK ] 0.97 sec.
2025-09-09 14:45:29 01605_drop_settings_profile_while_assigned: [ OK ] 0.32 sec.
2025-09-09 14:45:30 01425_default_value_of_type_name: [ OK ] 0.32 sec.
2025-09-09 14:45:30 02886_binary_like: [ OK ] 0.37 sec.
2025-09-09 14:45:30 02383_join_and_filtering_set: [ OK ] 3.73 sec.
2025-09-09 14:45:30 02163_operators: [ OK ] 0.32 sec.
2025-09-09 14:45:30 03165_parseReadableSize: [ OK ] 0.67 sec.
2025-09-09 14:45:30 03040_array_sum_and_join: [ OK ] 0.37 sec.
2025-09-09 14:45:31 01410_nullable_key_and_index: [ OK ] 0.67 sec.
2025-09-09 14:45:31 00752_low_cardinality_left_array_join: [ OK ] 0.37 sec.
2025-09-09 14:45:31 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 3.68 sec.
2025-09-09 14:45:31 02517_uuid_parsing: [ OK ] 0.32 sec.
2025-09-09 14:45:31 02340_union_header: [ OK ] 0.32 sec.
2025-09-09 14:45:31 01615_two_args_function_index_fix: [ OK ] 0.37 sec.
2025-09-09 14:45:32 00351_select_distinct_arrays_tuples: [ OK ] 0.32 sec.
2025-09-09 14:45:32 02944_variant_as_common_type_analyzer: [ OK ] 0.62 sec.
2025-09-09 14:45:32 02862_sorted_distinct_sparse_fix: [ OK ] 0.37 sec.
2025-09-09 14:45:32 02346_fulltext_index_bug47393: [ OK ] 0.37 sec.
2025-09-09 14:45:32 00276_sample: [ OK ] 1.57 sec.
2025-09-09 14:45:33 00975_json_hang: [ OK ] 0.57 sec.
2025-09-09 14:45:33 02746_index_analysis_binary_operator_with_null: [ OK ] 0.42 sec.
2025-09-09 14:45:33 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.32 sec.
2025-09-09 14:45:33 02400_memory_accounting_on_error: [ OK ] 0.42 sec.
2025-09-09 14:45:33 00589_removal_unused_columns_aggregation: [ OK ] 0.67 sec.
2025-09-09 14:45:33 02872_prewhere_filter: [ OK ] 0.38 sec.
2025-09-09 14:45:34 02721_url_cluster: [ OK ] 0.67 sec.
2025-09-09 14:45:34 01559_aggregate_null_for_empty_fix: [ OK ] 0.42 sec.
2025-09-09 14:45:35 00740_optimize_predicate_expression: [ OK ] 0.37 sec.
2025-09-09 14:45:35 01509_format_raw_blob: [ OK ] 1.77 sec.
2025-09-09 14:45:36 01505_pipeline_executor_UAF: [ OK ] 6.89 sec.
2025-09-09 14:45:36 01903_correct_block_size_prediction_with_default: [ OK ] 10.49 sec.
2025-09-09 14:45:36 02293_http_header_full_summary_without_progress: [ OK ] 1.62 sec.
2025-09-09 14:45:36 02790_fix_coredump_when_compile_expression: [ OK ] 0.27 sec.
2025-09-09 14:45:37 01497_alias_on_default_array: [ OK ] 0.42 sec.
2025-09-09 14:45:37 00299_stripe_log_multiple_inserts: [ OK ] 0.47 sec.
2025-09-09 14:45:37 00898_parsing_bad_diagnostic_message: [ OK ] 0.92 sec.
2025-09-09 14:45:38 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.52 sec.
2025-09-09 14:45:38 03167_parametrized_view_with_cte: [ OK ] 0.42 sec.
2025-09-09 14:45:38 03057_analyzer_subquery_alias_join: [ OK ] 0.32 sec.
2025-09-09 14:45:38 02340_analyzer_functions: [ OK ] 0.37 sec.
2025-09-09 14:45:39 03212_thousand_exceptions: [ OK ] 8.40 sec.
2025-09-09 14:45:39 00084_summing_merge_tree: [ OK ] 0.47 sec.
2025-09-09 14:45:39 02206_format_override: [ OK ] 1.27 sec.
2025-09-09 14:45:39 01685_json_extract_double_as_float: [ OK ] 0.32 sec.
2025-09-09 14:45:39 00499_json_enum_insert: [ OK ] 0.37 sec.
2025-09-09 14:45:39 02444_async_broken_outdated_part_loading: [ OK ] 5.84 sec.
2025-09-09 14:45:39 02910_bad_logs_level_in_local: [ OK ] 0.22 sec.
2025-09-09 14:45:40 01059_storage_file_compression: [ OK ] 15.51 sec.
2025-09-09 14:45:40 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.62 sec.
2025-09-09 14:45:40 02999_scalar_subqueries_bug_2: [ OK ] 0.37 sec.
2025-09-09 14:45:40 00334_column_aggregate_function_limit: [ OK ] 0.37 sec.
2025-09-09 14:45:40 01914_ubsan_quantile_timing: [ OK ] 0.32 sec.
2025-09-09 14:45:40 01554_interpreter_integer_float: [ OK ] 0.37 sec.
2025-09-09 14:45:41 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.37 sec.
2025-09-09 14:45:41 02584_compressor_codecs: [ OK ] 1.02 sec.
2025-09-09 14:45:41 00560_float_leading_plus_in_exponent: [ OK ] 0.32 sec.
2025-09-09 14:45:41 00613_shard_distributed_max_execution_time: [ OK ] 0.32 sec.
2025-09-09 14:45:41 02255_broken_parts_chain_on_start: [ OK ] 6.38 sec.
2025-09-09 14:45:42 03199_fix_auc_tie_handling: [ OK ] 0.42 sec.
2025-09-09 14:45:42 01308_orc_output_format_arrays: [ OK ] 1.87 sec.
2025-09-09 14:45:42 02722_matcher_join_use_nulls: [ OK ] 0.82 sec.
2025-09-09 14:45:42 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.62 sec.
2025-09-09 14:45:42 00647_select_numbers_with_offset: [ OK ] 0.32 sec.
2025-09-09 14:45:43 02457_filesystem_function: [ OK ] 0.32 sec.
2025-09-09 14:45:44 01825_new_type_json_multiple_files: [ OK ] 4.43 sec.
2025-09-09 14:45:44 00622_select_in_parens: [ OK ] 0.37 sec.
2025-09-09 14:45:44 02012_compress_lz4: [ OK ] 1.32 sec.
2025-09-09 14:45:44 02540_duplicate_primary_key2: [ OK ] 0.38 sec.
2025-09-09 14:45:45 02493_numeric_literals_with_underscores: [ OK ] 0.83 sec.
2025-09-09 14:45:45 02421_type_json_async_insert: [ OK ] 3.09 sec.
2025-09-09 14:45:46 02787_transform_null: [ OK ] 0.43 sec.
2025-09-09 14:45:46 02514_tsv_zero_started_number: [ OK ] 0.28 sec.
2025-09-09 14:45:47 00098_1_union_all: [ OK ] 0.43 sec.
2025-09-09 14:45:47 01288_shard_max_network_bandwidth: [ OK ] 2.90 sec.
2025-09-09 14:45:47 01096_block_serialized_state: [ OK ] 0.42 sec.
2025-09-09 14:45:47 02947_dropped_tables_parts: [ OK ] 0.42 sec.
2025-09-09 14:45:47 01413_truncate_without_table_keyword: [ OK ] 0.42 sec.
2025-09-09 14:45:48 01825_new_type_json_7: [ OK ] 2.59 sec.
2025-09-09 14:45:48 02247_read_bools_as_numbers_json: [ OK ] 6.91 sec.
2025-09-09 14:45:48 00826_cross_to_inner_join: [ OK ] 0.67 sec.
2025-09-09 14:45:48 00161_rounding_functions: [ OK ] 0.77 sec.
2025-09-09 14:45:48 01795_TinyLog_rwlock_ub: [ OK ] 0.34 sec.
2025-09-09 14:45:49 00810_in_operators_segfault: [ OK ] 0.37 sec.
2025-09-09 14:45:49 01359_codeql: [ OK ] 0.32 sec.
2025-09-09 14:45:49 01034_JSONCompactEachRow: [ OK ] 0.97 sec.
2025-09-09 14:45:49 02481_i43247_ubsan_in_minmaxany: [ OK ] 1.54 sec.
2025-09-09 14:45:50 00090_union_race_conditions_1: [ OK ] 10.42 sec.
2025-09-09 14:45:50 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.38 sec.
2025-09-09 14:45:50 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.47 sec.
2025-09-09 14:45:50 01039_row_policy_dcl: [ OK ] 1.13 sec.
2025-09-09 14:45:50 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.49 sec.
2025-09-09 14:45:50 02402_merge_engine_with_view: [ OK ] 0.42 sec.
2025-09-09 14:45:51 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.43 sec.
2025-09-09 14:45:51 02210_processors_profile_log: [ OK ] 2.60 sec.
2025-09-09 14:45:51 01440_big_int_exotic_casts: [ OK ] 0.68 sec.
2025-09-09 14:45:51 03161_decimal_binary_math: [ OK ] 0.88 sec.
2025-09-09 14:45:51 02267_jsonlines_ndjson_format: [ OK ] 0.42 sec.
2025-09-09 14:45:51 01413_alter_update_supertype: [ OK ] 0.43 sec.
2025-09-09 14:45:51 01442_merge_detach_attach_long: [ SKIPPED ] 0.00 sec.
2025-09-09 14:45:51 Reason: not running for current build
2025-09-09 14:45:52 02714_date_date32_in: [ OK ] 0.48 sec.
2025-09-09 14:45:53 02490_replacing_merge_tree_is_deleted_column: [ OK ] 1.65 sec.
2025-09-09 14:45:53 00014_select_from_table_with_nested: [ OK ] 0.48 sec.
2025-09-09 14:45:53 02713_array_low_cardinality_string: [ OK ] 0.43 sec.
2025-09-09 14:45:53 00534_functions_bad_arguments8: [ SKIPPED ] 0.00 sec.
2025-09-09 14:45:53 Reason: not running for current build
2025-09-09 14:45:54 03019_numbers_pretty: [ OK ] 0.37 sec.
2025-09-09 14:45:54 02124_buffer_with_type_map_long: [ OK ] 11.59 sec.
2025-09-09 14:45:54 00661_array_has_silviucpp: [ OK ] 0.37 sec.
2025-09-09 14:45:54 02968_full_sorting_join_fuzz: [ OK ] 3.09 sec.
2025-09-09 14:45:54 02515_aggregate_functions_statistics: [ OK ] 0.47 sec.
2025-09-09 14:45:54 00950_test_gorilla_codec: [ OK ] 0.43 sec.
2025-09-09 14:45:55 02661_quantile_approx: [ OK ] 0.68 sec.
2025-09-09 14:45:55 01960_lambda_precedence: [ OK ] 0.37 sec.
2025-09-09 14:45:55 02112_skip_index_set_and_or: [ OK ] 0.42 sec.
2025-09-09 14:45:56 01721_join_implicit_cast_long: [ OK ] 5.61 sec.
2025-09-09 14:45:56 01893_jit_aggregation_function_min_long: [ OK ] 1.17 sec.
2025-09-09 14:45:57 00825_protobuf_format_splitted_nested: [ OK ] 2.38 sec.
2025-09-09 14:45:57 01356_initialize_aggregation: [ OK ] 0.42 sec.
2025-09-09 14:45:57 03228_variant_permutation_issue: [ OK ] 0.52 sec.
2025-09-09 14:45:57 02935_http_content_type_with_http_headers_progress: [ OK ] 6.42 sec.
2025-09-09 14:45:57 01651_lc_insert_tiny_log_2: [ OK ] 4.35 sec.
2025-09-09 14:45:57 02354_window_expression_with_aggregation_expression: [ OK ] 0.32 sec.
2025-09-09 14:45:57 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.32 sec.
2025-09-09 14:45:57 02798_explain_settings_not_applied_bug: [ OK ] 0.37 sec.
2025-09-09 14:45:58 00808_not_optimize_predicate: [ OK ] 0.52 sec.
2025-09-09 14:45:58 01044_h3_edge_angle: [ OK ] 0.37 sec.
2025-09-09 14:45:58 01032_cityHash64_for_decimal: [ OK ] 0.37 sec.
2025-09-09 14:45:58 00465_nullable_default: [ OK ] 0.32 sec.
2025-09-09 14:45:58 02025_nested_func_for_if_combinator: [ OK ] 0.42 sec.
2025-09-09 14:45:58 01866_datetime64_cmp_with_constant: [ OK ] 0.42 sec.
2025-09-09 14:45:58 03143_cte_scope: [ OK ] 0.37 sec.
2025-09-09 14:45:58 01746_long_zlib_http_compression_json_format: [ OK ] 0.77 sec.
2025-09-09 14:45:59 01651_map_functions: [ OK ] 0.67 sec.
2025-09-09 14:45:59 02471_wrong_date_monotonicity: [ OK ] 0.32 sec.
2025-09-09 14:45:59 02420_stracktrace_debug_symbols: [ OK ] 0.77 sec.
2025-09-09 14:46:00 00154_shard_distributed_with_distinct: [ OK ] 0.32 sec.
2025-09-09 14:46:00 00100_subquery_table_identifier: [ OK ] 2.02 sec.
2025-09-09 14:46:00 00522_multidimensional: [ OK ] 0.67 sec.
2025-09-09 14:46:00 01667_aes_args_check: [ OK ] 0.37 sec.
2025-09-09 14:46:00 03144_fuzz_quoted_type_name: [ OK ] 0.32 sec.
2025-09-09 14:46:00 03167_base64_url_functions_sh: [ OK ] 55.83 sec.
2025-09-09 14:46:00 01072_drop_temporary_table_with_same_name: [ OK ] 0.42 sec.
2025-09-09 14:46:00 01031_pmj_new_any_semi_join: [ OK ] 0.42 sec.
2025-09-09 14:46:00 02355_control_block_size_in_array_join: [ OK ] 0.47 sec.
2025-09-09 14:46:01 03040_dynamic_type_alters_1_memory: [ OK ] 0.57 sec.
2025-09-09 14:46:01 01139_asof_join_types: [ OK ] 0.37 sec.
2025-09-09 14:46:01 02988_ordinary_database_warning: [ OK ] 0.32 sec.
2025-09-09 14:46:01 01031_mutations_interpreter_and_context: [ OK ] 2.47 sec.
2025-09-09 14:46:01 00649_quantile_tdigest_negative: [ OK ] 0.32 sec.
2025-09-09 14:46:01 01894_jit_aggregation_function_max_long: [ OK ] 1.07 sec.
2025-09-09 14:46:02 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.47 sec.
2025-09-09 14:46:02 02426_to_string_nullable_fixedstring: [ OK ] 0.32 sec.
2025-09-09 14:46:02 01690_quantilesTiming_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:46:02 02815_alias_to_length: [ OK ] 0.37 sec.
2025-09-09 14:46:02 01009_global_array_join_names: [ OK ] 0.37 sec.
2025-09-09 14:46:03 02174_cte_scalar_cache_mv: [ OK ] 2.17 sec.
2025-09-09 14:46:03 01926_date_date_time_supertype: [ OK ] 0.37 sec.
2025-09-09 14:46:03 01710_projection_row_policy: [ OK ] 0.37 sec.
2025-09-09 14:46:03 01651_lc_insert_tiny_log_1: [ OK ] 2.42 sec.
2025-09-09 14:46:03 00673_subquery_prepared_set_performance: [ OK ] 0.62 sec.
2025-09-09 14:46:04 01272_offset_without_limit: [ OK ] 0.32 sec.
2025-09-09 14:46:04 01596_setting_limit_offset: [ OK ] 0.57 sec.
2025-09-09 14:46:05 02457_morton_coding: [ OK ] 0.67 sec.
2025-09-09 14:46:05 00311_array_primary_key: [ OK ] 0.37 sec.
2025-09-09 14:46:05 02122_parallel_formatting_Pretty: [ OK ] 4.23 sec.
2025-09-09 14:46:05 02969_analyzer_eliminate_injective_functions: [ OK ] 0.37 sec.
2025-09-09 14:46:05 02122_parallel_formatting_CustomSeparated: [ OK ] 2.07 sec.
2025-09-09 14:46:06 02556_local_with_totals_and_extremes: [ OK ] 0.72 sec.
2025-09-09 14:46:06 01602_runningConcurrency: [ OK ] 0.47 sec.
2025-09-09 14:46:06 00743_limit_by_not_found_column: [ OK ] 0.37 sec.
2025-09-09 14:46:07 03168_query_log_privileges_not_empty: [ OK ] 4.63 sec.
2025-09-09 14:46:07 01119_session_log: [ OK ] 30.74 sec.
2025-09-09 14:46:07 01866_view_persist_settings: [ OK ] 0.67 sec.
2025-09-09 14:46:07 02271_temporary_table_show_rows_bytes: [ OK ] 0.32 sec.
2025-09-09 14:46:07 02344_describe_cache: [ OK ] 1.52 sec.
2025-09-09 14:46:07 03303_alias_inverse_order: [ OK ] 0.37 sec.
2025-09-09 14:46:07 00513_fractional_time_zones: [ OK ] 0.32 sec.
2025-09-09 14:46:07 03217_filtering_in_storage_merge: [ OK ] 0.37 sec.
2025-09-09 14:46:07 02676_kafka_murmur_hash: [ OK ] 0.32 sec.
2025-09-09 14:46:08 03001_data_version_column: [ OK ] 0.37 sec.
2025-09-09 14:46:08 03164_linestring_geometry: [ OK ] 0.32 sec.
2025-09-09 14:46:08 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec.
2025-09-09 14:46:08 Reason: not running for current build
2025-09-09 14:46:08 01097_pre_limit: [ OK ] 0.32 sec.
2025-09-09 14:46:08 00471_sql_style_quoting: [ OK ] 0.32 sec.
2025-09-09 14:46:08 01381_for_each_with_states: [ OK ] 0.37 sec.
2025-09-09 14:46:08 02981_translate_fixedstring: [ OK ] 0.32 sec.
2025-09-09 14:46:08 02972_parallel_replicas_cte: [ OK ] 0.52 sec.
2025-09-09 14:46:09 01338_long_select_and_alter: [ OK ] 13.96 sec.
2025-09-09 14:46:09 01825_type_json_ephemeral: [ OK ] 0.32 sec.
2025-09-09 14:46:09 02220_array_join_format: [ OK ] 0.32 sec.
2025-09-09 14:46:09 02221_system_zookeeper_unrestricted_like: [ OK ] 3.08 sec.
2025-09-09 14:46:09 00751_low_cardinality_nullable_group_by: [ OK ] 0.87 sec.
2025-09-09 14:46:09 01071_in_array: [ OK ] 0.32 sec.
2025-09-09 14:46:10 00472_create_view_if_not_exists: [ OK ] 0.32 sec.
2025-09-09 14:46:10 03154_recursive_cte_distributed: [ OK ] 0.52 sec.
2025-09-09 14:46:10 03039_dynamic_summing_merge_tree: [ OK ] 12.96 sec.
2025-09-09 14:46:10 00373_group_by_tuple: [ OK ] 0.32 sec.
2025-09-09 14:46:10 03261_json_hints_types_check: [ OK ] 0.42 sec.
2025-09-09 14:46:10 02353_translate: [ OK ] 0.42 sec.
2025-09-09 14:46:10 02842_mutations_replace_non_deterministic: [ OK ] 0.97 sec.
2025-09-09 14:46:10 00120_join_and_group_by: [ OK ] 0.32 sec.
2025-09-09 14:46:11 01355_CSV_input_format_allow_errors: [ OK ] 1.77 sec.
2025-09-09 14:46:11 02900_window_function_with_sparse_column: [ OK ] 0.42 sec.
2025-09-09 14:46:11 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.47 sec.
2025-09-09 14:46:11 00914_replicate: [ OK ] 0.32 sec.
2025-09-09 14:46:11 02476_fix_lambda_parsing: [ OK ] 0.72 sec.
2025-09-09 14:46:11 01925_jit_aggregation_function_count_long: [ OK ] 0.37 sec.
2025-09-09 14:46:11 00834_limit_with_constant_expressions: [ OK ] 0.52 sec.
2025-09-09 14:46:11 03006_join_on_inequal_expression_3: [ OK ] 0.62 sec.
2025-09-09 14:46:12 00483_reading_from_array_structure: [ OK ] 0.52 sec.
2025-09-09 14:46:12 01845_add_testcase_for_arrayElement: [ OK ] 0.37 sec.
2025-09-09 14:46:12 01849_geoToS2: [ OK ] 0.62 sec.
2025-09-09 14:46:12 01273_arrow_arrays_load: [ OK ] 2.57 sec.
2025-09-09 14:46:12 01901_in_literal_shard_prune: [ OK ] 0.37 sec.
2025-09-09 14:46:12 02834_formats_with_variable_number_of_columns: [ OK ] 0.52 sec.
2025-09-09 14:46:13 01818_move_partition_simple: [ OK ] 0.47 sec.
2025-09-09 14:46:13 01445_create_table_as_table_function: [ OK ] 1.53 sec.
2025-09-09 14:46:13 02315_readonly_create_function: [ OK ] 0.92 sec.
2025-09-09 14:46:13 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec.
2025-09-09 14:46:13 Reason: not running for current build
2025-09-09 14:46:13 03036_reading_s3_archives: [ OK ] 0.82 sec.
2025-09-09 14:46:13 00447_foreach_modifier: [ OK ] 0.42 sec.
2025-09-09 14:46:13 02121_pager: [ OK ] 1.03 sec.
2025-09-09 14:46:13 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.37 sec.
2025-09-09 14:46:14 00558_parse_floats: [ OK ] 0.32 sec.
2025-09-09 14:46:14 01358_lc_parquet: [ OK ] 6.03 sec.
2025-09-09 14:46:14 00458_merge_type_cast: [ OK ] 0.67 sec.
2025-09-09 14:46:14 01657_array_element_ubsan: [ OK ] 0.37 sec.
2025-09-09 14:46:14 01351_geohash_assert: [ OK ] 0.32 sec.
2025-09-09 14:46:14 00625_arrays_in_nested: [ OK ] 0.52 sec.
2025-09-09 14:46:14 01375_null_issue_3767: [ OK ] 0.37 sec.
2025-09-09 14:46:14 00878_join_unexpected_results: [ OK ] 0.67 sec.
2025-09-09 14:46:15 01030_limit_by_with_ties_error: [ OK ] 1.57 sec.
2025-09-09 14:46:15 02763_row_policy_storage_merge_alias: [ OK ] 0.52 sec.
2025-09-09 14:46:15 00072_in_types: [ OK ] 0.32 sec.
2025-09-09 14:46:15 02900_clickhouse_local_drop_current_database: [ OK ] 0.72 sec.
2025-09-09 14:46:15 02498_storage_join_key_positions: [ OK ] 0.97 sec.
2025-09-09 14:46:15 03199_queries_with_new_analyzer: [ OK ] 0.37 sec.
2025-09-09 14:46:16 02594_msgpack_more_types: [ OK ] 0.92 sec.
2025-09-09 14:46:16 02201_use_skip_indexes_if_final: [ OK ] 0.42 sec.
2025-09-09 14:46:16 02932_group_by_null_fuzzer: [ OK ] 0.32 sec.
2025-09-09 14:46:16 02591_bson_long_tuple: [ OK ] 0.32 sec.
2025-09-09 14:46:16 03020_output_format_client: [ OK ] 2.12 sec.
2025-09-09 14:46:16 02716_int256_arrayfunc: [ OK ] 0.37 sec.
2025-09-09 14:46:16 03098_prefer_column_to_alias_subquery: [ OK ] 0.47 sec.
2025-09-09 14:46:16 00252_shard_global_in_aggregate_function: [ OK ] 0.42 sec.
2025-09-09 14:46:17 01882_check_max_parts_to_merge_at_once: [ OK ] 0.82 sec.
2025-09-09 14:46:17 00678_shard_funnel_window: [ OK ] 0.47 sec.
2025-09-09 14:46:17 02921_file_engine_size_virtual_column: [ OK ] 1.12 sec.
2025-09-09 14:46:17 01497_extract_all_groups_empty_match: [ OK ] 0.32 sec.
2025-09-09 14:46:17 01710_projection_external_aggregate: [ OK ] 0.37 sec.
2025-09-09 14:46:17 00240_replace_substring_loop: [ OK ] 1.02 sec.
2025-09-09 14:46:18 02475_join_bug_42832: [ OK ] 0.37 sec.
2025-09-09 14:46:18 01958_partial_hour_timezone: [ OK ] 0.42 sec.
2025-09-09 14:46:18 02911_analyzer_explain_estimate: [ OK ] 0.32 sec.
2025-09-09 14:46:18 01411_xor_itai_shirav: [ OK ] 0.32 sec.
2025-09-09 14:46:18 02493_analyzer_table_functions_untuple: [ OK ] 0.42 sec.
2025-09-09 14:46:18 03039_dynamic_collapsing_merge_tree: [ OK ] 11.10 sec.
2025-09-09 14:46:19 02986_leftpad_fixedstring: [ OK ] 0.47 sec.
2025-09-09 14:46:19 02366_kql_mvexpand: [ OK ] 0.57 sec.
2025-09-09 14:46:19 00989_parallel_parts_loading: [ OK ] 2.28 sec.
2025-09-09 14:46:19 00931_low_cardinality_read_with_empty_array: [ OK ] 0.62 sec.
2025-09-09 14:46:19 02317_distinct_in_order_optimization_explain: [ OK ] 15.61 sec.
2025-09-09 14:46:19 01662_join_mixed: [ OK ] 0.37 sec.
2025-09-09 14:46:20 02496_row_binary_large_string_size: [ OK ] 0.82 sec.
2025-09-09 14:46:20 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 1.27 sec.
2025-09-09 14:46:20 00916_join_using_duplicate_columns: [ OK ] 0.47 sec.
2025-09-09 14:46:20 00844_join_lightee2: [ OK ] 0.42 sec.
2025-09-09 14:46:21 00037_totals_limit: [ OK ] 0.32 sec.
2025-09-09 14:46:21 01774_case_sensitive_connection_id: [ OK ] 0.37 sec.
2025-09-09 14:46:21 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 5.69 sec.
2025-09-09 14:46:21 01428_h3_range_check: [ OK ] 0.42 sec.
2025-09-09 14:46:21 00906_low_cardinality_rollup: [ OK ] 0.42 sec.
2025-09-09 14:46:21 01058_zlib_ng_level1_bug: [ OK ] 2.07 sec.
2025-09-09 14:46:22 01518_cast_nullable_virtual_system_column: [ OK ] 0.32 sec.
2025-09-09 14:46:22 02477_invalid_reads: [ OK ] 0.92 sec.
2025-09-09 14:46:22 02723_param_exception_message_context: [ OK ] 0.92 sec.
2025-09-09 14:46:22 02692_multiple_joins_unicode: [ OK ] 0.37 sec.
2025-09-09 14:46:22 02475_or_function_alias_and_const_where: [ OK ] 0.32 sec.
2025-09-09 14:46:22 03167_fancy_quotes_off_by_one: [ OK ] 0.32 sec.
2025-09-09 14:46:23 02009_body_query_params: [ OK ] 0.62 sec.
2025-09-09 14:46:23 02874_array_random_sample: [ OK ] 5.08 sec.
2025-09-09 14:46:23 00712_prewhere_with_alias_bug_2: [ OK ] 0.32 sec.
2025-09-09 14:46:23 02141_clickhouse_local_interactive_table: [ OK ] 0.87 sec.
2025-09-09 14:46:23 01748_partition_id_pruning: [ OK ] 0.42 sec.
2025-09-09 14:46:23 02243_in_ip_address: [ OK ] 0.37 sec.
2025-09-09 14:46:24 02380_analyzer_join_sample: [ OK ] 0.37 sec.
2025-09-09 14:46:24 00578_merge_table_and_table_virtual_column: [ OK ] 0.47 sec.
2025-09-09 14:46:24 01055_prewhere_bugs: [ OK ] 0.37 sec.
2025-09-09 14:46:24 00473_output_format_json_quote_denormals: [ OK ] 2.27 sec.
2025-09-09 14:46:24 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec.
2025-09-09 14:46:24 Reason: not running for current build
2025-09-09 14:46:24 01083_cross_to_inner_with_in_bug: [ OK ] 0.37 sec.
2025-09-09 14:46:25 02367_analyzer_table_alias_columns: [ OK ] 0.37 sec.
2025-09-09 14:46:25 02784_projections_read_in_order_bug: [ OK ] 0.42 sec.
2025-09-09 14:46:26 00652_mutations_alter_update: [ OK ] 13.00 sec.
2025-09-09 14:46:26 01710_projections_and_duplicate_columms: [ OK ] 0.37 sec.
2025-09-09 14:46:26 02480_client_option_print_num_processed_rows: [ OK ] 2.22 sec.
2025-09-09 14:46:27 00976_max_execution_speed: [ OK ] 3.28 sec.
2025-09-09 14:46:27 03015_peder1001: [ OK ] 0.32 sec.
2025-09-09 14:46:27 03168_fuzz_multiIf_short_circuit: [ OK ] 0.37 sec.
2025-09-09 14:46:27 01039_mergetree_exec_time: [ OK ] 1.37 sec.
2025-09-09 14:46:28 03001_bad_error_message_higher_order_functions: [ OK ] 0.87 sec.
2025-09-09 14:46:28 02941_projections_external_aggregation: [ OK ] 1.12 sec.
2025-09-09 14:46:28 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.32 sec.
2025-09-09 14:46:29 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 0.77 sec.
2025-09-09 14:46:29 02875_merge_engine_set_index: [ OK ] 1.77 sec.
2025-09-09 14:46:29 01710_projections_optimize_aggregation_in_order: [ OK ] 5.38 sec.
2025-09-09 14:46:30 00957_delta_diff_bug: [ OK ] 0.32 sec.
2025-09-09 14:46:30 02581_share_big_sets_between_mutation_tasks: [ OK ] 8.64 sec.
2025-09-09 14:46:30 00688_low_cardinality_serialization: [ OK ] 2.12 sec.
2025-09-09 14:46:30 00459_group_array_insert_at: [ OK ] 0.37 sec.
2025-09-09 14:46:30 03166_optimize_row_order_during_insert: [ OK ] 0.47 sec.
2025-09-09 14:46:30 01323_add_scalars_in_time: [ OK ] 0.42 sec.
2025-09-09 14:46:30 00839_bitmask_negative: [ OK ] 0.37 sec.
2025-09-09 14:46:31 02833_local_udf_options: [ OK ] 0.72 sec.
2025-09-09 14:46:31 00976_system_stop_ttl_merges: [ OK ] 1.37 sec.
2025-09-09 14:46:31 02956_clickhouse_local_system_parts: [ OK ] 0.87 sec.
2025-09-09 14:46:31 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.37 sec.
2025-09-09 14:46:31 02280_add_query_level_settings: [ OK ] 0.37 sec.
2025-09-09 14:46:31 01011_test_create_as_skip_indices: [ OK ] 0.32 sec.
2025-09-09 14:46:31 02543_alter_update_rename_stuck: [ OK ] 5.73 sec.
2025-09-09 14:46:31 01255_geo_types_livace: [ OK ] 0.32 sec.
2025-09-09 14:46:31 02887_tuple_element_distributed: [ OK ] 0.32 sec.
2025-09-09 14:46:31 00679_uuid_in_key: [ OK ] 0.37 sec.
2025-09-09 14:46:31 02426_pod_array_overflow_2: [ OK ] 0.32 sec.
2025-09-09 14:46:32 00700_decimal_math: [ OK ] 0.47 sec.
2025-09-09 14:46:32 00957_neighbor: [ OK ] 0.57 sec.
2025-09-09 14:46:32 00940_order_by_read_in_order_query_plan: [ OK ] 1.12 sec.
2025-09-09 14:46:32 02489_analyzer_indexes: [ OK ] 0.52 sec.
2025-09-09 14:46:32 01451_wrong_error_long_query: [ OK ] 0.62 sec.
2025-09-09 14:46:32 01831_max_streams: [ OK ] 0.32 sec.
2025-09-09 14:46:32 01640_distributed_async_insert_compression: [ OK ] 0.37 sec.
2025-09-09 14:46:33 01259_dictionary_custom_settings_ddl: [ OK ] 0.37 sec.
2025-09-09 14:46:33 03007_column_nullable_uninitialzed_value: [ OK ] 0.32 sec.
2025-09-09 14:46:33 01089_alter_settings_old_format: [ OK ] 0.32 sec.
2025-09-09 14:46:34 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.42 sec.
2025-09-09 14:46:34 00113_shard_group_array: [ OK ] 1.97 sec.
2025-09-09 14:46:34 00453_top_k: [ OK ] 0.32 sec.
2025-09-09 14:46:35 02461_mullable_pk_monotonicity_bug: [ OK ] 0.62 sec.
2025-09-09 14:46:35 03151_pmj_join_non_procssed_clash: [ OK ] 0.42 sec.
2025-09-09 14:46:35 02889_print_pretty_type_names: [ OK ] 0.32 sec.
2025-09-09 14:46:36 00210_insert_select_extremes_http: [ OK ] 0.62 sec.
2025-09-09 14:46:36 00497_whitespaces_in_insert: [ OK ] 4.78 sec.
2025-09-09 14:46:37 02324_map_combinator_bug: [ OK ] 0.47 sec.
2025-09-09 14:46:37 01273_arrow: [ OK ] 17.96 sec.
2025-09-09 14:46:41 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.33 sec.
2025-09-09 14:46:41 02994_merge_tree_mutations_cleanup: [ OK ] 10.44 sec.
2025-09-09 14:46:43 02993_lazy_index_loading: [ OK ] 1.17 sec.
2025-09-09 14:46:43 00315_quantile_off_by_one: [ OK ] 0.32 sec.
2025-09-09 14:46:43 00695_pretty_max_column_pad_width: [ OK ] 0.37 sec.
2025-09-09 14:46:44 02572_query_views_log_background_thread: [ OK ] 13.15 sec.
2025-09-09 14:46:44 01518_filtering_aliased_materialized_column: [ OK ] 0.37 sec.
2025-09-09 14:46:45 02967_parallel_replicas_joins_and_analyzer: [ OK ] 1.98 sec.
2025-09-09 14:46:45 02521_tsv_csv_custom_header_detection: [ OK ] 8.34 sec.
2025-09-09 14:46:46 02242_if_then_else_null_bug: [ OK ] 0.37 sec.
2025-09-09 14:46:46 02962_analyzer_constant_set: [ OK ] 0.37 sec.
2025-09-09 14:46:46 00680_duplicate_columns_inside_union_all: [ OK ] 0.42 sec.
2025-09-09 14:46:47 02033_join_engine_deadlock_long: [ OK ] 2.68 sec.
2025-09-09 14:46:48 02941_variant_type_1: [ OK ] 15.76 sec.
2025-09-09 14:46:48 01548_uncomparable_columns_in_keys: [ OK ] 0.32 sec.
2025-09-09 14:46:49 02285_hex_bin_support_more_types: [ OK ] 0.42 sec.
2025-09-09 14:46:49 01451_replicated_detach_drop_part_long: [ OK ] 0.62 sec.
2025-09-09 14:46:50 01542_collate_in_array: [ OK ] 0.37 sec.
2025-09-09 14:46:50 01040_dictionary_invalidate_query_switchover_long: [ OK ] 15.41 sec.
2025-09-09 14:46:51 02423_ddl_for_opentelemetry: [ OK ] 9.40 sec.
2025-09-09 14:46:51 01781_merge_tree_deduplication: [ OK ] 1.02 sec.
2025-09-09 14:46:51 02552_client_format_settings: [ OK ] 0.32 sec.
2025-09-09 14:46:51 02907_preferred_optimize_projection_name: [ OK ] 5.68 sec.
2025-09-09 14:46:51 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.37 sec.
2025-09-09 14:46:51 01012_serialize_array_memory_usage: [ OK ] 0.47 sec.
2025-09-09 14:46:52 01825_type_json_18: [ OK ] 0.37 sec.
2025-09-09 14:46:52 03200_subcolumns_join_use_nulls: [ OK ] 0.42 sec.
2025-09-09 14:46:52 01119_optimize_trivial_insert_select: [ OK ] 0.62 sec.
2025-09-09 14:46:52 02988_join_using_prewhere_pushdown: [ OK ] 0.32 sec.
2025-09-09 14:46:52 02713_ip4_uint_compare: [ OK ] 0.32 sec.
2025-09-09 14:46:53 00441_nulls_in: [ OK ] 0.47 sec.
2025-09-09 14:46:53 02149_schema_inference: [ OK ] 16.17 sec.
2025-09-09 14:46:53 01914_index_bgranvea: [ OK ] 0.37 sec.
2025-09-09 14:46:53 02113_untuple_func_alias: [ OK ] 0.32 sec.
2025-09-09 14:46:53 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 6.89 sec.
2025-09-09 14:46:53 03058_analyzer_ambiguous_columns: [ OK ] 0.42 sec.
2025-09-09 14:46:53 01353_low_cardinality_join_types: [ OK ] 0.67 sec.
2025-09-09 14:46:54 02481_pk_analysis_with_enum_to_string: [ OK ] 0.47 sec.
2025-09-09 14:46:54 01786_group_by_pk_many_streams: [ OK ] 0.52 sec.
2025-09-09 14:46:54 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.47 sec.
2025-09-09 14:46:54 00262_alter_alias: [ OK ] 0.42 sec.
2025-09-09 14:46:54 00574_empty_strings_deserialization: [ OK ] 2.62 sec.
2025-09-09 14:46:54 03208_buffer_over_distributed_type_mismatch: [ OK ] 0.67 sec.
2025-09-09 14:46:54 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ OK ] 0.72 sec.
2025-09-09 14:46:54 00411_long_accurate_number_comparison_int4: [ OK ] 4.53 sec.
2025-09-09 14:46:55 00700_to_decimal_or_something: [ OK ] 0.72 sec.
2025-09-09 14:46:55 02189_join_type_conversion: [ OK ] 0.32 sec.
2025-09-09 14:46:55 01702_system_numbers_scientific_notation: [ OK ] 0.37 sec.
2025-09-09 14:46:55 00209_insert_select_extremes: [ OK ] 0.42 sec.
2025-09-09 14:46:55 00988_constraints_replication_zookeeper_long: [ OK ] 0.52 sec.
2025-09-09 14:46:55 00725_join_on_bug_1: [ OK ] 0.37 sec.
2025-09-09 14:46:55 00580_consistent_hashing_functions: [ OK ] 0.37 sec.
2025-09-09 14:46:55 02523_range_const_start: [ OK ] 0.47 sec.
2025-09-09 14:46:55 03006_buffer_overflow_join: [ OK ] 0.32 sec.
2025-09-09 14:46:56 01753_optimize_aggregation_in_order: [ OK ] 0.87 sec.
2025-09-09 14:46:56 00637_sessions_in_http_interface_and_settings: [ OK ] 0.62 sec.
2025-09-09 14:46:56 00386_long_in_pk: [ OK ] 9.19 sec.
2025-09-09 14:46:56 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.32 sec.
2025-09-09 14:46:57 01423_if_nullable_cond: [ OK ] 0.32 sec.
2025-09-09 14:46:57 00444_join_use_nulls: [ OK ] 0.37 sec.
2025-09-09 14:46:57 02782_avro_decimals: [ OK ] 0.93 sec.
2025-09-09 14:46:57 02982_dont_infer_exponent_floats: [ OK ] 0.32 sec.
2025-09-09 14:46:57 00603_system_parts_nonexistent_database: [ OK ] 0.32 sec.
2025-09-09 14:46:57 02008_test_union_distinct_in_subquery: [ OK ] 0.52 sec.
2025-09-09 14:46:58 02021_exponential_sum_shard: [ OK ] 0.67 sec.
2025-09-09 14:46:58 02263_format_insert_settings: [ OK ] 3.53 sec.
2025-09-09 14:46:58 02800_transform_alter: [ OK ] 0.42 sec.
2025-09-09 14:46:59 00698_validate_array_sizes_for_nested: [ OK ] 0.37 sec.
2025-09-09 14:46:59 02896_leading_zeroes_no_octal: [ OK ] 1.42 sec.
2025-09-09 14:46:59 00609_distributed_with_case_when_then: [ OK ] 0.37 sec.
2025-09-09 14:46:59 01518_nullable_aggregate_states1: [ OK ] 0.42 sec.
2025-09-09 14:46:59 01284_port: [ OK ] 0.62 sec.
2025-09-09 14:46:59 01079_alter_default_zookeeper_long: [ OK ] 0.62 sec.
2025-09-09 14:47:00 02043_query_obfuscator_embedded_dictionaries: [ OK ] 0.57 sec.
2025-09-09 14:47:00 01256_misspell_layout_name_podshumok: [ OK ] 0.32 sec.
2025-09-09 14:47:00 01646_rewrite_sum_if: [ OK ] 0.62 sec.
2025-09-09 14:47:00 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.42 sec.
2025-09-09 14:47:00 01710_projection_with_mixed_pipeline: [ OK ] 0.37 sec.
2025-09-09 14:47:00 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.37 sec.
2025-09-09 14:47:01 02417_null_variadic_behaviour: [ OK ] 0.57 sec.
2025-09-09 14:47:01 03009_format_show_database: [ OK ] 0.97 sec.
2025-09-09 14:47:01 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 5.93 sec.
2025-09-09 14:47:01 03084_analyzer_join_column_alias: [ OK ] 0.37 sec.
2025-09-09 14:47:02 02493_analyzer_sum_if_to_count_if: [ OK ] 0.37 sec.
2025-09-09 14:47:02 00674_join_on_syntax: [ OK ] 1.02 sec.
2025-09-09 14:47:02 01533_distinct_depends_on_max_threads: [ OK ] 0.62 sec.
2025-09-09 14:47:02 02734_sparse_columns_short_circuit: [ OK ] 0.42 sec.
2025-09-09 14:47:02 01011_group_uniq_array_memsan: [ OK ] 0.32 sec.
2025-09-09 14:47:02 02125_lz4_compression_bug_CSV: [ OK ] 5.68 sec.
2025-09-09 14:47:02 02811_csv_input_field_type_mismatch: [ OK ] 1.97 sec.
2025-09-09 14:47:03 00952_input_function: [ OK ] 8.99 sec.
2025-09-09 14:47:03 01300_svg: [ OK ] 0.57 sec.
2025-09-09 14:47:03 03130_analyzer_self_join_group_by: [ OK ] 0.37 sec.
2025-09-09 14:47:03 01034_with_fill_and_push_down_predicate: [ OK ] 0.32 sec.
2025-09-09 14:47:03 00002_system_numbers: [ OK ] 0.37 sec.
2025-09-09 14:47:03 00847_multiple_join_same_column: [ OK ] 0.42 sec.
2025-09-09 14:47:03 00495_reading_const_zero_column: [ OK ] 0.37 sec.
2025-09-09 14:47:03 00258_materializing_tuples: [ OK ] 0.37 sec.
2025-09-09 14:47:03 02551_obfuscator_keywords: [ OK ] 0.62 sec.
2025-09-09 14:47:03 03100_analyzer_constants_in_multiif: [ OK ] 0.32 sec.
2025-09-09 14:47:04 01750_parsing_exception: [ OK ] 0.97 sec.
2025-09-09 14:47:04 00004_shard_format_ast_and_remote_table: [ OK ] 0.32 sec.
2025-09-09 14:47:04 01302_polygons_distance: [ OK ] 0.37 sec.
2025-09-09 14:47:04 02725_object_column_alter: [ OK ] 0.32 sec.
2025-09-09 14:47:04 01710_projection_detach_part: [ OK ] 0.37 sec.
2025-09-09 14:47:04 01821_join_table_mutation: [ OK ] 0.47 sec.
2025-09-09 14:47:04 00514_interval_operators: [ OK ] 0.42 sec.
2025-09-09 14:47:04 02803_backup_tmp_files: [ OK ] 1.62 sec.
2025-09-09 14:47:05 01600_multiple_left_join_with_aliases: [ OK ] 0.37 sec.
2025-09-09 14:47:05 01532_collate_in_low_cardinality: [ OK ] 0.37 sec.
2025-09-09 14:47:05 02845_parquet_odd_decimals: [ OK ] 1.67 sec.
2025-09-09 14:47:05 01410_full_join_and_null_predicates: [ OK ] 0.52 sec.
2025-09-09 14:47:06 01034_move_partition_from_table_zookeeper: [ OK ] 46.29 sec.
2025-09-09 14:47:06 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.83 sec.
2025-09-09 14:47:06 01043_dictionary_attribute_properties_values: [ OK ] 0.37 sec.
2025-09-09 14:47:06 02111_with_fill_no_rows: [ OK ] 0.32 sec.
2025-09-09 14:47:06 01602_modified_julian_day_msan: [ OK ] 0.42 sec.
2025-09-09 14:47:06 01832_memory_write_suffix: [ OK ] 0.37 sec.
2025-09-09 14:47:07 02096_date_time_1970_saturation: [ OK ] 0.52 sec.
2025-09-09 14:47:07 03172_http_content_encoding: [ OK ] 2.27 sec.
2025-09-09 14:47:07 02408_to_fixed_string_short_circuit: [ OK ] 0.37 sec.
2025-09-09 14:47:07 02316_const_string_intersact: [ OK ] 0.32 sec.
2025-09-09 14:47:07 00448_to_string_cut_to_zero: [ OK ] 0.32 sec.
2025-09-09 14:47:07 00981_in_subquery_with_tuple: [ OK ] 3.33 sec.
2025-09-09 14:47:07 01414_freeze_does_not_prevent_alters: [ OK ] 0.47 sec.
2025-09-09 14:47:07 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.62 sec.
2025-09-09 14:47:08 01021_only_tuple_columns: [ OK ] 0.42 sec.
2025-09-09 14:47:08 02287_ephemeral_format_crash: [ OK ] 0.32 sec.
2025-09-09 14:47:08 01581_deduplicate_by_columns_local: [ OK ] 0.82 sec.
2025-09-09 14:47:08 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.52 sec.
2025-09-09 14:47:09 02000_table_function_cluster_macros: [ OK ] 0.32 sec.
2025-09-09 14:47:09 01576_if_null_external_aggregation: [ OK ] 1.22 sec.
2025-09-09 14:47:09 01623_byte_size_const: [ OK ] 0.32 sec.
2025-09-09 14:47:09 01825_new_type_json_parallel_insert: [ OK ] 0.47 sec.
2025-09-09 14:47:09 00819_ast_refactoring_bugs: [ OK ] 0.42 sec.
2025-09-09 14:47:09 03130_convert_outer_join_to_inner_join: [ OK ] 0.47 sec.
2025-09-09 14:47:09 01170_alter_partition_isolation: [ OK ] 4.18 sec.
2025-09-09 14:47:09 03222_json_squashing: [ OK ] 1.83 sec.
2025-09-09 14:47:10 00151_tuple_with_array: [ OK ] 0.32 sec.
2025-09-09 14:47:10 02152_dictionary_date32_type: [ OK ] 0.37 sec.
2025-09-09 14:47:10 02026_accurate_cast_or_default: [ OK ] 0.57 sec.
2025-09-09 14:47:10 00173_compare_date_time_with_constant_string: [ OK ] 0.67 sec.
2025-09-09 14:47:10 00626_replace_partition_from_table: [ OK ] 0.67 sec.
2025-09-09 14:47:10 01710_projection_optimize_group_by_function_keys: [ OK ] 0.42 sec.
2025-09-09 14:47:10 01121_remote_scalar_subquery: [ OK ] 0.43 sec.
2025-09-09 14:47:10 01915_json_extract_raw_string: [ OK ] 0.32 sec.
2025-09-09 14:47:10 00960_eval_ml_method_const: [ OK ] 0.32 sec.
2025-09-09 14:47:10 00234_disjunctive_equality_chains_optimization: [ OK ] 0.32 sec.
2025-09-09 14:47:10 01392_column_resolve: [ OK ] 0.37 sec.
2025-09-09 14:47:10 00487_if_array_fixed_string: [ OK ] 0.42 sec.
2025-09-09 14:47:11 01047_no_alias_columns_with_table_aliases: [ OK ] 0.37 sec.
2025-09-09 14:47:11 02476_analyzer_join_with_unused_columns: [ OK ] 0.42 sec.
2025-09-09 14:47:11 00954_client_prepared_statements: [ OK ] 5.14 sec.
2025-09-09 14:47:11 02943_order_by_all: [ OK ] 0.62 sec.
2025-09-09 14:47:11 00131_set_hashed: [ OK ] 0.37 sec.
2025-09-09 14:47:11 00570_empty_array_is_const: [ OK ] 0.32 sec.
2025-09-09 14:47:11 03032_rmt_create_columns_from_replica: [ OK ] 0.27 sec.
2025-09-09 14:47:11 01014_function_repeat_corner_cases: [ OK ] 0.42 sec.
2025-09-09 14:47:11 02751_query_log_test_partitions: [ OK ] 0.87 sec.
2025-09-09 14:47:11 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.32 sec.
2025-09-09 14:47:11 01045_array_zip: [ OK ] 0.37 sec.
2025-09-09 14:47:11 00521_multidimensional: [ OK ] 0.47 sec.
2025-09-09 14:47:12 00717_merge_and_distributed: [ OK ] 1.12 sec.
2025-09-09 14:47:12 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.37 sec.
2025-09-09 14:47:12 01136_multiple_sets: [ OK ] 0.37 sec.
2025-09-09 14:47:12 02480_analyzer_alias_nullptr: [ OK ] 0.32 sec.
2025-09-09 14:47:12 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.57 sec.
2025-09-09 14:47:12 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.42 sec.
2025-09-09 14:47:12 02474_timeDiff_UTCTimestamp: [ OK ] 0.32 sec.
2025-09-09 14:47:12 02864_profile_event_part_lock: [ OK ] 0.37 sec.
2025-09-09 14:47:12 00195_shard_union_all_and_global_in: [ OK ] 0.37 sec.
2025-09-09 14:47:12 00577_full_join_segfault: [ OK ] 0.32 sec.
2025-09-09 14:47:12 00178_query_datetime64_index: [ OK ] 0.32 sec.
2025-09-09 14:47:12 02133_issue_32458: [ OK ] 0.37 sec.
2025-09-09 14:47:13 03164_parallel_replicas_range_filter_min_max: [ OK ] 0.72 sec.
2025-09-09 14:47:13 01293_pretty_max_value_width: [ OK ] 0.47 sec.
2025-09-09 14:47:13 01122_totals_rollup_having_block_header: [ OK ] 0.37 sec.
2025-09-09 14:47:13 00213_multiple_global_in: [ OK ] 0.32 sec.
2025-09-09 14:47:13 00825_protobuf_format_squares: [ OK ] 1.97 sec.
2025-09-09 14:47:13 01232_untuple: [ OK ] 0.42 sec.
2025-09-09 14:47:13 02841_parallel_final_wrong_columns_order: [ OK ] 1.32 sec.
2025-09-09 14:47:13 02002_sampling_and_unknown_column_bug: [ OK ] 0.32 sec.
2025-09-09 14:47:13 01144_multiword_data_types: [ OK ] 0.27 sec.
2025-09-09 14:47:14 01042_check_query_and_last_granule_size: [ OK ] 0.47 sec.
2025-09-09 14:47:14 03003_functions_to_subcolumns_final: [ OK ] 0.42 sec.
2025-09-09 14:47:14 01603_read_with_backoff_bug: [ OK ] 9.29 sec.
2025-09-09 14:47:14 00617_array_in: [ OK ] 0.42 sec.
2025-09-09 14:47:15 02360_send_logs_level_colors: [ OK ] 1.47 sec.
2025-09-09 14:47:15 02206_clickhouse_local_use_database: [ OK ] 0.77 sec.
2025-09-09 14:47:15 00534_functions_bad_arguments1: [ SKIPPED ] 0.00 sec.
2025-09-09 14:47:15 Reason: not running for current build
2025-09-09 14:47:15 02451_variadic_null_garbage_data: [ OK ] 0.42 sec.
2025-09-09 14:47:15 01076_json_each_row_array: [ OK ] 0.97 sec.
2025-09-09 14:47:15 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.57 sec.
2025-09-09 14:47:16 02115_map_contains_analyzer: [ OK ] 0.37 sec.
2025-09-09 14:47:16 01523_interval_operator_support_string_literal: [ OK ] 0.42 sec.
2025-09-09 14:47:16 01650_expressions_merge_bug: [ OK ] 0.37 sec.
2025-09-09 14:47:17 02592_avro_more_types: [ OK ] 0.97 sec.
2025-09-09 14:47:17 02372_analyzer_join: [ OK ] 3.93 sec.
2025-09-09 14:47:17 02294_floating_point_second_in_settings: [ OK ] 4.58 sec.
2025-09-09 14:47:17 00534_exp10: [ OK ] 0.32 sec.
2025-09-09 14:47:17 01922_sum_null_for_remote: [ OK ] 0.37 sec.
2025-09-09 14:47:17 00612_count: [ OK ] 0.42 sec.
2025-09-09 14:47:18 01825_new_type_json_3: [ OK ] 0.87 sec.
2025-09-09 14:47:18 02010_lc_native: [ OK ] 1.72 sec.
2025-09-09 14:47:18 02179_degrees_radians: [ OK ] 0.42 sec.
2025-09-09 14:47:18 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.32 sec.
2025-09-09 14:47:18 03199_join_with_materialized_column: [ OK ] 0.32 sec.
2025-09-09 14:47:18 02514_bad_index_granularity: [ OK ] 0.32 sec.
2025-09-09 14:47:19 02900_issue_55858: [ OK ] 0.52 sec.
2025-09-09 14:47:19 02800_clickhouse_local_default_settings: [ OK ] 0.72 sec.
2025-09-09 14:47:19 01851_s2_to_geo: [ OK ] 0.37 sec.
2025-09-09 14:47:19 01670_test_repeat_mysql_dialect: [ OK ] 0.42 sec.
2025-09-09 14:47:19 01430_fix_any_rewrite_aliases: [ OK ] 0.38 sec.
2025-09-09 14:47:20 00605_intersections_aggregate_functions: [ OK ] 0.52 sec.
2025-09-09 14:47:20 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 2.22 sec.
2025-09-09 14:47:20 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 5.98 sec.
2025-09-09 14:47:20 00821_distributed_storage_with_join_on: [ OK ] 0.47 sec.
2025-09-09 14:47:20 02785_global_join_too_many_columns: [ OK ] 0.37 sec.
2025-09-09 14:47:20 00591_columns_removal_union_all: [ OK ] 0.32 sec.
2025-09-09 14:47:21 02741_hashed_dictionary_load_factor: [ OK ] 1.12 sec.
2025-09-09 14:47:21 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.37 sec.
2025-09-09 14:47:21 03037_dot_product_overflow: [ OK ] 0.32 sec.
2025-09-09 14:47:21 02023_storage_filelog: [ OK ] 5.83 sec.
2025-09-09 14:47:22 02366_kql_tabular: [ OK ] 0.52 sec.
2025-09-09 14:47:22 02535_json_bson_each_row_curl: [ OK ] 2.02 sec.
2025-09-09 14:47:22 01353_nullable_tuple: [ OK ] 0.77 sec.
2025-09-09 14:47:22 00726_materialized_view_concurrent: [ OK ] 0.37 sec.
2025-09-09 14:47:22 02864_replace_regexp_string_fallback: [ OK ] 0.37 sec.
2025-09-09 14:47:22 01846_alter_column_without_type_bugfix: [ OK ] 0.27 sec.
2025-09-09 14:47:22 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.57 sec.
2025-09-09 14:47:23 01303_polygons_equals: [ OK ] 0.32 sec.
2025-09-09 14:47:23 01684_insert_specify_shard_id: [ OK ] 0.57 sec.
2025-09-09 14:47:23 03039_unknown_identifier_window_function: [ OK ] 0.32 sec.
2025-09-09 14:47:23 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.37 sec.
2025-09-09 14:47:23 01560_optimize_on_insert_zookeeper: [ OK ] 0.47 sec.
2025-09-09 14:47:23 03068_analyzer_distributed_join: [ OK ] 0.52 sec.
2025-09-09 14:47:23 00903_array_with_constant_function: [ OK ] 0.32 sec.
2025-09-09 14:47:23 01825_new_type_json_8: [ OK ] 3.63 sec.
2025-09-09 14:47:24 00508_materialized_view_to: [ OK ] 0.42 sec.
2025-09-09 14:47:24 01273_lc_fixed_string_field: [ OK ] 0.37 sec.
2025-09-09 14:47:24 01259_datetime64_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:47:24 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.32 sec.
2025-09-09 14:47:24 01412_row_from_totals: [ OK ] 0.47 sec.
2025-09-09 14:47:24 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.37 sec.
2025-09-09 14:47:25 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.42 sec.
2025-09-09 14:47:25 02158_ztest: [ OK ] 0.37 sec.
2025-09-09 14:47:25 02970_visible_width_behavior: [ OK ] 0.37 sec.
2025-09-09 14:47:25 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.32 sec.
2025-09-09 14:47:26 02286_tuple_numeric_identifier: [ OK ] 0.37 sec.
2025-09-09 14:47:26 02922_respect_nulls_parser: [ OK ] 0.52 sec.
2025-09-09 14:47:26 03246_skipping_index_70108: [ OK ] 0.87 sec.
2025-09-09 14:47:26 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.27 sec.
2025-09-09 14:47:26 03039_recursive_cte_postgres_5: [ OK ] 0.47 sec.
2025-09-09 14:47:26 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec.
2025-09-09 14:47:26 Reason: not running for current build
2025-09-09 14:47:26 03006_mv_deduplication_throw_if_async_insert: [ OK ] 5.58 sec.
2025-09-09 14:47:26 01116_cross_count_asterisks: [ OK ] 0.37 sec.
2025-09-09 14:47:27 00197_if_fixed_string: [ OK ] 0.32 sec.
2025-09-09 14:47:27 00804_test_custom_compression_codecs: [ OK ] 0.82 sec.
2025-09-09 14:47:27 02499_analyzer_set_index: [ OK ] 0.37 sec.
2025-09-09 14:47:27 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.32 sec.
2025-09-09 14:47:27 00732_decimal_summing_merge_tree: [ OK ] 0.37 sec.
2025-09-09 14:47:27 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.37 sec.
2025-09-09 14:47:28 03156_nullable_number_tips: [ OK ] 0.47 sec.
2025-09-09 14:47:28 00192_least_greatest: [ OK ] 0.42 sec.
2025-09-09 14:47:28 03207_json_read_subcolumns_1_memory: [ OK ] 1.17 sec.
2025-09-09 14:47:28 02868_select_support_from_keywords: [ OK ] 0.27 sec.
2025-09-09 14:47:29 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.52 sec.
2025-09-09 14:47:29 02244_ip_address_invalid_insert: [ OK ] 0.57 sec.
2025-09-09 14:47:29 01352_generate_random_overflow: [ OK ] 0.32 sec.
2025-09-09 14:47:30 00273_quantiles: [ OK ] 0.57 sec.
2025-09-09 14:47:30 00738_lock_for_inner_table: [ OK ] 16.41 sec.
2025-09-09 14:47:30 02015_async_inserts_2: [ OK ] 1.02 sec.
2025-09-09 14:47:30 02122_parallel_formatting_Vertical: [ OK ] 2.77 sec.
2025-09-09 14:47:30 01019_materialized_view_select_extra_columns: [ OK ] 0.42 sec.
2025-09-09 14:47:30 00053_all_inner_join: [ OK ] 0.32 sec.
2025-09-09 14:47:30 02012_sha512_fixedstring: [ OK ] 0.32 sec.
2025-09-09 14:47:31 02313_test_fpc_codec: [ OK ] 0.52 sec.
2025-09-09 14:47:31 02575_merge_prewhere_default_expression: [ OK ] 0.42 sec.
2025-09-09 14:47:31 03165_storage_merge_view_prewhere: [ OK ] 0.42 sec.
2025-09-09 14:47:31 02294_decimal_second_errors: [ OK ] 0.32 sec.
2025-09-09 14:47:31 03036_parquet_arrow_nullable: [ OK ] 5.83 sec.
2025-09-09 14:47:32 01558_ttest_scipy: [ OK ] 1.77 sec.
2025-09-09 14:47:32 01528_to_uuid_or_null_or_zero: [ OK ] 0.47 sec.
2025-09-09 14:47:32 02151_client_option_echo: [ OK ] 1.72 sec.
2025-09-09 14:47:32 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec.
2025-09-09 14:47:32 Reason: not running for current build
2025-09-09 14:47:32 02381_parse_array_of_tuples: [ OK ] 0.32 sec.
2025-09-09 14:47:32 02560_analyzer_materialized_view: [ OK ] 0.43 sec.
2025-09-09 14:47:33 03145_asof_join_ddb_inequalities: [ OK ] 0.47 sec.
2025-09-09 14:47:33 01621_clickhouse_compressor: [ OK ] 0.72 sec.
2025-09-09 14:47:33 00411_long_accurate_number_comparison_int1: [ OK ] 14.61 sec.
2025-09-09 14:47:33 01358_constexpr_constraint: [ OK ] 0.32 sec.
2025-09-09 14:47:33 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.32 sec.
2025-09-09 14:47:33 03038_nested_dynamic_merges_small: [ OK ] 1.47 sec.
2025-09-09 14:47:33 01247_least_greatest_filimonov: [ OK ] 0.37 sec.
2025-09-09 14:47:34 00437_nulls_first_last: [ OK ] 0.52 sec.
2025-09-09 14:47:34 01837_cast_to_array_from_empty_array: [ OK ] 0.32 sec.
2025-09-09 14:47:34 01701_clear_projection_and_part_remove: [ OK ] 0.42 sec.
2025-09-09 14:47:34 00712_nan_comparison: [ OK ] 0.47 sec.
2025-09-09 14:47:34 00218_like_regexp_newline: [ OK ] 0.37 sec.
2025-09-09 14:47:34 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 2.78 sec.
2025-09-09 14:47:34 00098_6_union_all: [ OK ] 0.32 sec.
2025-09-09 14:47:34 03031_clickhouse_local_input: [ OK ] 1.07 sec.
2025-09-09 14:47:35 01388_multi_if_optimization: [ OK ] 0.37 sec.
2025-09-09 14:47:35 02788_current_schemas_function: [ OK ] 0.37 sec.
2025-09-09 14:47:35 02769_compare_functions_nan: [ OK ] 0.52 sec.
2025-09-09 14:47:35 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.57 sec.
2025-09-09 14:47:35 00753_comment_columns_zookeeper: [ OK ] 0.32 sec.
2025-09-09 14:47:35 02789_reading_from_s3_with_connection_pool: [ OK ] 4.03 sec.
2025-09-09 14:47:35 02813_array_agg: [ OK ] 0.37 sec.
2025-09-09 14:47:35 03041_recursive_cte_postgres_7: [ OK ] 0.57 sec.
2025-09-09 14:47:35 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.37 sec.
2025-09-09 14:47:35 02477_analyzer_array_join_with_join: [ OK ] 0.67 sec.
2025-09-09 14:47:36 00975_sample_prewhere_distributed: [ OK ] 0.37 sec.
2025-09-09 14:47:36 02366_kql_func_ip: [ OK ] 1.67 sec.
2025-09-09 14:47:36 03162_dynamic_type_nested: [ OK ] 0.37 sec.
2025-09-09 14:47:36 02354_vector_search_bugs: [ OK ] 0.62 sec.
2025-09-09 14:47:36 02810_async_insert_dedup_replicated_collapsing: [ OK ] 12.50 sec.
2025-09-09 14:47:36 02366_kql_func_dynamic: [ OK ] 1.22 sec.
2025-09-09 14:47:36 02791_final_block_structure_mismatch_bug: [ OK ] 0.62 sec.
2025-09-09 14:47:36 02841_join_filter_set_sparse: [ OK ] 0.47 sec.
2025-09-09 14:47:36 02596_build_set_and_remote: [ OK ] 0.67 sec.
2025-09-09 14:47:37 01732_union_and_union_all: [ OK ] 0.27 sec.
2025-09-09 14:47:37 00379_system_processes_port: [ OK ] 0.62 sec.
2025-09-09 14:47:37 02354_vector_search_legacy_index_compatibility: [ OK ] 0.47 sec.
2025-09-09 14:47:37 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.37 sec.
2025-09-09 14:47:37 03198_settings_in_csv_tsv_schema_cache: [ OK ] 1.17 sec.
2025-09-09 14:47:37 01353_neighbor_overflow: [ OK ] 0.37 sec.
2025-09-09 14:47:37 01921_test_progress_bar: [ OK ] 0.47 sec.
2025-09-09 14:47:38 03204_format_join_on: [ OK ] 0.62 sec.
2025-09-09 14:47:38 00331_final_and_prewhere: [ OK ] 0.42 sec.
2025-09-09 14:47:38 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 1.87 sec.
2025-09-09 14:47:38 02702_allow_skip_errors_enum: [ OK ] 1.62 sec.
2025-09-09 14:47:38 03037_dynamic_merges_2_vertical_compact_merge_tree: [ OK ] 0.62 sec.
2025-09-09 14:47:38 02875_fix_column_decimal_serialization: [ OK ] 0.37 sec.
2025-09-09 14:47:38 02813_series_period_detect: [ OK ] 0.52 sec.
2025-09-09 14:47:38 00357_to_string_complex_types: [ OK ] 0.32 sec.
2025-09-09 14:47:39 00794_materialized_view_with_column_defaults: [ OK ] 0.37 sec.
2025-09-09 14:47:39 03215_varian_as_common_type_integers: [ OK ] 0.37 sec.
2025-09-09 14:47:39 02705_grouping_keys_equal_keys: [ OK ] 0.32 sec.
2025-09-09 14:47:39 03087_analyzer_subquery_with_alias: [ OK ] 0.32 sec.
2025-09-09 14:47:39 00647_histogram: [ OK ] 0.37 sec.
2025-09-09 14:47:39 00007_array: [ OK ] 0.37 sec.
2025-09-09 14:47:40 01292_quantile_array_bug: [ OK ] 0.37 sec.
2025-09-09 14:47:40 01780_column_sparse_tuple: [ OK ] 0.47 sec.
2025-09-09 14:47:40 02813_func_now_and_alias: [ OK ] 0.42 sec.
2025-09-09 14:47:40 01825_type_json_15: [ OK ] 2.72 sec.
2025-09-09 14:47:40 02570_fallback_from_async_insert: [ OK ] 3.02 sec.
2025-09-09 14:47:41 00857_global_joinsavel_table_alias: [ OK ] 0.52 sec.
2025-09-09 14:47:41 02771_ignore_data_skipping_indices: [ OK ] 0.47 sec.
2025-09-09 14:47:41 01906_bigint_accurate_cast_ubsan: [ OK ] 0.47 sec.
2025-09-09 14:47:41 00832_storage_file_lock: [ OK ] 0.37 sec.
2025-09-09 14:47:41 00199_ternary_operator_type_check: [ OK ] 0.62 sec.
2025-09-09 14:47:41 02918_optimize_count_for_merge_tables: [ OK ] 0.42 sec.
2025-09-09 14:47:41 02366_kql_func_math: [ OK ] 0.37 sec.
2025-09-09 14:47:41 03143_group_by_constant_secondary: [ OK ] 0.37 sec.
2025-09-09 14:47:42 02680_datetime64_monotonic_check: [ OK ] 0.37 sec.
2025-09-09 14:47:42 02384_analyzer_dict_get_join_get: [ OK ] 0.52 sec.
2025-09-09 14:47:43 01681_bloom_filter_nullable_column: [ OK ] 0.52 sec.
2025-09-09 14:47:43 02160_special_functions: [ OK ] 0.47 sec.
2025-09-09 14:47:43 03198_orc_read_time_zone: [ OK ] 2.02 sec.
2025-09-09 14:47:44 02508_index_analysis_to_date_timezone: [ OK ] 0.42 sec.
2025-09-09 14:47:44 02150_index_hypothesis_race_long: [ OK ] 5.28 sec.
2025-09-09 14:47:44 02734_sparse_columns_mutation: [ OK ] 0.52 sec.
2025-09-09 14:47:44 02316_values_table_func_bug: [ OK ] 0.32 sec.
2025-09-09 14:47:44 01055_compact_parts_1: [ OK ] 0.32 sec.
2025-09-09 14:47:44 03215_parquet_index: [ OK ] 0.37 sec.
2025-09-09 14:47:44 02564_read_in_order_final_desc: [ OK ] 0.37 sec.
2025-09-09 14:47:44 00127_group_by_concat: [ OK ] 0.32 sec.
2025-09-09 14:47:45 02518_delete_on_materialized_view: [ OK ] 0.37 sec.
2025-09-09 14:47:45 03198_unload_primary_key_outdated: [ OK ] 3.18 sec.
2025-09-09 14:47:45 03222_datetime64_small_value_const: [ OK ] 0.62 sec.
2025-09-09 14:47:45 02935_format_with_arbitrary_types: [ OK ] 0.72 sec.
2025-09-09 14:47:45 02131_used_row_policies_in_query_log: [ OK ] 0.97 sec.
2025-09-09 14:47:46 02953_slow_create_view: [ OK ] 0.37 sec.
2025-09-09 14:47:46 01104_distributed_one_test: [ OK ] 0.42 sec.
2025-09-09 14:47:46 02241_short_circuit_short_column: [ OK ] 0.37 sec.
2025-09-09 14:47:46 02503_in_lc_const_args_bug: [ OK ] 0.32 sec.
2025-09-09 14:47:46 00432_aggregate_function_scalars_and_constants: [ OK ] 0.47 sec.
2025-09-09 14:47:46 02235_check_table_sparse_serialization: [ OK ] 0.32 sec.
2025-09-09 14:47:47 03033_lightweight_deletes_sync: [ OK ] 0.42 sec.
2025-09-09 14:47:47 02733_sparse_columns_reload: [ OK ] 0.42 sec.
2025-09-09 14:47:47 01852_s2_get_neighbours: [ OK ] 0.32 sec.
2025-09-09 14:47:48 01825_type_json_4: [ OK ] 3.18 sec.
2025-09-09 14:47:48 01230_join_get_truncate: [ OK ] 0.37 sec.
2025-09-09 14:47:49 02361_fsync_profile_events: [ OK ] 1.77 sec.
2025-09-09 14:47:50 02473_multistep_prewhere: [ OK ] 12.00 sec.
2025-09-09 14:47:50 02240_get_type_serialization_streams: [ OK ] 0.32 sec.
2025-09-09 14:47:50 02465_limit_trivial_max_rows_to_read: [ OK ] 0.42 sec.
2025-09-09 14:47:51 03012_parser_backtracking: [ OK ] 5.18 sec.
2025-09-09 14:47:51 02317_distinct_in_order_optimization: [ OK ] 1.12 sec.
2025-09-09 14:47:51 02130_parse_quoted_null: [ OK ] 4.98 sec.
2025-09-09 14:47:51 02510_group_by_prewhere_null: [ OK ] 0.32 sec.
2025-09-09 14:47:51 01666_lcm_ubsan: [ OK ] 0.47 sec.
2025-09-09 14:47:52 00292_parser_tuple_element: [ OK ] 0.27 sec.
2025-09-09 14:47:52 02496_remove_redundant_sorting_analyzer: [ OK ] 11.61 sec.
2025-09-09 14:47:53 01293_client_interactive_vertical_singleline: [ OK ] 0.87 sec.
2025-09-09 14:47:53 02346_fulltext_index_bug52019: [ OK ] 0.37 sec.
2025-09-09 14:47:53 00503_cast_const_nullable: [ OK ] 0.32 sec.
2025-09-09 14:47:53 00851_http_insert_json_defaults: [ OK ] 1.62 sec.
2025-09-09 14:47:53 01825_type_json_ghdata: [ OK ] 5.58 sec.
2025-09-09 14:47:54 01077_mutations_index_consistency: [ OK ] 3.63 sec.
2025-09-09 14:47:54 02369_analyzer_array_join_function: [ OK ] 0.42 sec.
2025-09-09 14:47:54 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.37 sec.
2025-09-09 14:47:54 00365_statistics_in_formats: [ OK ] 2.73 sec.
2025-09-09 14:47:54 03047_analyzer_alias_join: [ OK ] 0.42 sec.
2025-09-09 14:47:55 01067_join_null: [ OK ] 0.47 sec.
2025-09-09 14:47:55 02933_group_by_memory_usage: [ OK ] 1.83 sec.
2025-09-09 14:47:55 00854_multiple_join_asterisks: [ OK ] 0.37 sec.
2025-09-09 14:47:55 01339_client_unrecognized_option: [ OK ] 0.93 sec.
2025-09-09 14:47:56 02113_base64encode_trailing_bytes_1: [ OK ] 0.28 sec.
2025-09-09 14:47:56 02267_type_inference_for_insert_into_function_null: [ OK ] 0.32 sec.
2025-09-09 14:47:56 01035_prewhere_with_alias: [ OK ] 0.42 sec.
2025-09-09 14:47:56 01774_tuple_null_in: [ OK ] 0.42 sec.
2025-09-09 14:47:56 02394_every_profile_event_must_have_documentation: [ OK ] 0.27 sec.
2025-09-09 14:47:56 02783_parallel_replicas_trivial_count_optimization: [ OK ] 3.88 sec.
2025-09-09 14:47:57 01282_system_parts_ttl_info: [ OK ] 0.42 sec.
2025-09-09 14:47:57 02831_trash: [ OK ] 0.32 sec.
2025-09-09 14:47:57 02016_aggregation_spark_bar: [ OK ] 0.72 sec.
2025-09-09 14:47:57 02188_table_function_format: [ OK ] 0.32 sec.
2025-09-09 14:47:57 00997_extract_all_crash_6627: [ OK ] 0.32 sec.
2025-09-09 14:47:57 02227_union_match_by_name: [ OK ] 0.32 sec.
2025-09-09 14:47:57 00033_fixed_string_to_string: [ OK ] 0.32 sec.
2025-09-09 14:47:58 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.42 sec.
2025-09-09 14:47:58 02876_yyyymmddtodate: [ OK ] 0.77 sec.
2025-09-09 14:47:58 01502_bar_overflow: [ OK ] 0.47 sec.
2025-09-09 14:47:58 01305_polygons_union: [ OK ] 0.42 sec.
2025-09-09 14:47:59 02751_multiif_to_if_crash: [ OK ] 0.32 sec.
2025-09-09 14:47:59 01079_order_by_pk: [ OK ] 4.48 sec.
2025-09-09 14:47:59 02345_filesystem_local: [ OK ] 0.72 sec.
2025-09-09 14:47:59 03321_functions_to_subcolumns_skip_index: [ OK ] 0.37 sec.
2025-09-09 14:47:59 00022_func_higher_order_and_constants: [ OK ] 0.37 sec.
2025-09-09 14:47:59 00843_optimize_predicate_and_rename_table: [ OK ] 0.37 sec.
2025-09-09 14:48:00 03010_sum_to_to_count_if_nullable: [ OK ] 0.37 sec.
2025-09-09 14:48:00 00745_compile_scalar_subquery: [ OK ] 0.52 sec.
2025-09-09 14:48:00 00834_kill_mutation_replicated_zookeeper: [ SKIPPED ] 0.00 sec.
2025-09-09 14:48:00 Reason: not running for current build
2025-09-09 14:48:00 02998_to_milliseconds: [ OK ] 0.48 sec.
2025-09-09 14:48:00 03221_merge_profile_events: [ OK ] 0.82 sec.
2025-09-09 14:48:00 02960_alter_table_part_query_parameter: [ OK ] 0.42 sec.
2025-09-09 14:48:01 02317_functions_with_nothing: [ OK ] 0.37 sec.
2025-09-09 14:48:01 01276_random_string: [ OK ] 1.12 sec.
2025-09-09 14:48:02 02014_map_different_keys: [ OK ] 0.42 sec.
2025-09-09 14:48:02 01947_mv_subquery: [ OK ] 1.02 sec.
2025-09-09 14:48:02 01648_mutations_and_escaping: [ OK ] 4.59 sec.
2025-09-09 14:48:02 02013_emptystring_cast: [ OK ] 0.42 sec.
2025-09-09 14:48:02 02501_analyzer_expired_context_crash_fix: [ OK ] 0.42 sec.
2025-09-09 14:48:03 02353_ascii: [ OK ] 0.37 sec.
2025-09-09 14:48:03 01685_ssd_cache_dictionary_complex_key: [ OK ] 1.17 sec.
2025-09-09 14:48:03 02366_kql_create_table: [ OK ] 0.47 sec.
2025-09-09 14:48:03 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.32 sec.
2025-09-09 14:48:03 01273_arrow_nested_arrays_load: [ OK ] 2.78 sec.
2025-09-09 14:48:04 00073_merge_sorting_empty_array_joined: [ OK ] 0.32 sec.
2025-09-09 14:48:04 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.32 sec.
2025-09-09 14:48:04 02294_dictionaries_hierarchical_index: [ OK ] 0.57 sec.
2025-09-09 14:48:04 02250_ON_CLUSTER_grant: [ OK ] 1.97 sec.
2025-09-09 14:48:04 03167_base64_url_functions: [ OK ] 0.42 sec.
2025-09-09 14:48:04 02495_concat_with_separator: [ OK ] 0.62 sec.
2025-09-09 14:48:05 01277_fromUnixTimestamp64: [ OK ] 0.47 sec.
2025-09-09 14:48:05 02536_date_from_number_inference_fix: [ OK ] 0.32 sec.
2025-09-09 14:48:05 01668_avg_weighted_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:48:05 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.37 sec.
2025-09-09 14:48:05 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.37 sec.
2025-09-09 14:48:06 02271_replace_partition_many_tables: [ OK ] 30.55 sec.
2025-09-09 14:48:06 02359_send_logs_source_regexp: [ OK ] 0.92 sec.
2025-09-09 14:48:06 00114_float_type_result_of_division: [ OK ] 0.32 sec.
2025-09-09 14:48:06 01660_join_or_all: [ OK ] 0.82 sec.
2025-09-09 14:48:06 00809_add_days_segfault: [ OK ] 0.42 sec.
2025-09-09 14:48:06 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.32 sec.
2025-09-09 14:48:06 02877_optimize_read_in_order_from_view: [ OK ] 2.78 sec.
2025-09-09 14:48:07 03197_storage_join_strictness_type_restriction: [ OK ] 0.42 sec.
2025-09-09 14:48:07 02814_create_index_uniq_noop: [ OK ] 0.32 sec.
2025-09-09 14:48:07 03152_analyzer_columns_list: [ OK ] 0.37 sec.
2025-09-09 14:48:07 02244_make_datetime: [ OK ] 0.52 sec.
2025-09-09 14:48:07 02366_explain_query_tree: [ OK ] 0.42 sec.
2025-09-09 14:48:07 03237_max_map_state_decimal_serialization: [ OK ] 0.37 sec.
2025-09-09 14:48:07 01323_redundant_functions_in_order_by: [ OK ] 0.62 sec.
2025-09-09 14:48:08 02025_having_filter_column: [ OK ] 0.37 sec.
2025-09-09 14:48:08 01521_alter_enum_and_reverse_read: [ OK ] 0.37 sec.
2025-09-09 14:48:08 02502_analyzer_insert_select_crash_fix: [ OK ] 0.37 sec.
2025-09-09 14:48:08 01088_benchmark_query_id: [ OK ] 1.62 sec.
2025-09-09 14:48:08 02354_parse_timedelta: [ OK ] 0.62 sec.
2025-09-09 14:48:09 01532_having_with_totals: [ OK ] 0.37 sec.
2025-09-09 14:48:09 00662_has_nullable: [ OK ] 0.37 sec.
2025-09-09 14:48:09 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.57 sec.
2025-09-09 14:48:09 00652_replicated_mutations_default_database_zookeeper: [ OK ] 1.77 sec.
2025-09-09 14:48:09 02429_combinators_in_array_reduce: [ OK ] 0.47 sec.
2025-09-09 14:48:09 02316_cast_to_ip_address_default_column: [ OK ] 0.42 sec.
2025-09-09 14:48:09 03036_dynamic_read_shared_subcolumns_memory: [ OK ] 16.36 sec.
2025-09-09 14:48:09 01283_max_threads_simple_query_optimization: [ OK ] 0.78 sec.
2025-09-09 14:48:10 03023_remove_unused_column_distinct: [ OK ] 0.42 sec.
2025-09-09 14:48:10 01825_type_json_2: [ OK ] 0.57 sec.
2025-09-09 14:48:10 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 0.72 sec.
2025-09-09 14:48:10 02513_broken_datetime64_init_on_mac: [ OK ] 0.32 sec.
2025-09-09 14:48:10 03262_test_parquet_native_reader_int_logical_type: [ OK ] 1.27 sec.
2025-09-09 14:48:10 03003_enum_and_string_compatible: [ OK ] 0.37 sec.
2025-09-09 14:48:10 00753_alter_attach: [ OK ] 1.27 sec.
2025-09-09 14:48:10 01944_insert_partition_by: [ OK ] 0.52 sec.
2025-09-09 14:48:10 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 16.86 sec.
2025-09-09 14:48:10 00069_date_arithmetic: [ OK ] 0.37 sec.
2025-09-09 14:48:11 02985_minmax_index_aggregate_function: [ OK ] 0.43 sec.
2025-09-09 14:48:11 02990_optimize_uniq_to_count_alias: [ OK ] 0.37 sec.
2025-09-09 14:48:11 01318_alter_add_column_exists: [ OK ] 0.32 sec.
2025-09-09 14:48:11 02376_analyzer_in_function_subquery: [ OK ] 0.47 sec.
2025-09-09 14:48:11 00975_recursive_materialized_view: [ OK ] 0.42 sec.
2025-09-09 14:48:11 01547_query_log_current_database: [ OK ] 0.57 sec.
2025-09-09 14:48:11 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 0.77 sec.
2025-09-09 14:48:11 01034_unknown_qualified_column_in_join: [ OK ] 0.42 sec.
2025-09-09 14:48:11 00348_tuples: [ OK ] 0.42 sec.
2025-09-09 14:48:11 01773_min_max_time_system_parts_datetime64: [ OK ] 0.37 sec.
2025-09-09 14:48:11 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2025-09-09 14:48:11 Reason: not running for current build
2025-09-09 14:48:11 01076_range_reader_segfault: [ OK ] 0.37 sec.
2025-09-09 14:48:11 00833_sleep_overflow: [ OK ] 0.27 sec.
2025-09-09 14:48:12 03001_block_offset_column: [ OK ] 0.52 sec.
2025-09-09 14:48:12 02949_parallel_replicas_in_subquery: [ OK ] 0.52 sec.
2025-09-09 14:48:12 03165_order_by_duplicate: [ OK ] 0.32 sec.
2025-09-09 14:48:12 00672_arrayDistinct: [ OK ] 0.37 sec.
2025-09-09 14:48:12 01592_length_map: [ OK ] 0.32 sec.
2025-09-09 14:48:12 02352_interactive_queries_from_file: [ OK ] 0.92 sec.
2025-09-09 14:48:13 02132_client_history_navigation: [ OK ] 0.92 sec.
2025-09-09 14:48:13 03002_analyzer_prewhere: [ OK ] 0.42 sec.
2025-09-09 14:48:13 01646_fix_window_funnel_inconistency: [ OK ] 0.42 sec.
2025-09-09 14:48:13 00875_join_right_nulls: [ OK ] 0.57 sec.
2025-09-09 14:48:13 01657_test_toHour_mysql_compatibility: [ OK ] 0.32 sec.
2025-09-09 14:48:13 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.52 sec.
2025-09-09 14:48:14 00372_cors_header: [ OK ] 0.62 sec.
2025-09-09 14:48:14 02705_settings_check_changed_flag: [ OK ] 0.67 sec.
2025-09-09 14:48:14 03008_uniq_exact_equal_ranges: [ OK ] 2.07 sec.
2025-09-09 14:48:14 02809_prewhere_and_in: [ OK ] 0.52 sec.
2025-09-09 14:48:14 02923_cte_equality_disjunction: [ OK ] 0.32 sec.
2025-09-09 14:48:14 00969_columns_clause: [ OK ] 0.47 sec.
2025-09-09 14:48:15 01881_create_as_tuple: [ OK ] 0.37 sec.
2025-09-09 14:48:15 00627_recursive_alias: [ OK ] 0.32 sec.
2025-09-09 14:48:15 01664_decimal_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:48:15 02154_bit_slice_for_fixedstring: [ OK ] 1.07 sec.
2025-09-09 14:48:15 01245_limit_infinite_sources: [ OK ] 0.92 sec.
2025-09-09 14:48:16 01049_join_low_card_bug_long: [ OK ] 4.58 sec.
2025-09-09 14:48:16 01825_type_json_5: [ OK ] 0.42 sec.
2025-09-09 14:48:16 01531_query_log_query_comment: [ OK ] 1.22 sec.
2025-09-09 14:48:16 00909_ngram_distance: [ OK ] 1.32 sec.
2025-09-09 14:48:16 02989_variant_comparison: [ OK ] 0.57 sec.
2025-09-09 14:48:17 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.37 sec.
2025-09-09 14:48:17 02949_ttl_group_by_bug: [ OK ] 0.37 sec.
2025-09-09 14:48:17 01402_cast_nullable_string_to_enum: [ OK ] 0.42 sec.
2025-09-09 14:48:17 01583_parallel_parsing_exception_with_offset: [ OK ] 3.58 sec.
2025-09-09 14:48:18 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.37 sec.
2025-09-09 14:48:18 03203_client_benchmark_options: [ OK ] 6.43 sec.
2025-09-09 14:48:18 00953_indices_alter_exceptions: [ OK ] 2.02 sec.
2025-09-09 14:48:18 02861_join_on_nullsafe_compare: [ OK ] 0.97 sec.
2025-09-09 14:48:19 00763_create_query_as_table_engine_bug: [ OK ] 0.32 sec.
2025-09-09 14:48:19 02358_file_default_value: [ OK ] 1.37 sec.
2025-09-09 14:48:19 02184_ipv6_select_parsing: [ OK ] 0.32 sec.
2025-09-09 14:48:19 02473_multistep_split_prewhere: [ OK ] 15.51 sec.
2025-09-09 14:48:20 01281_sum_nullable: [ OK ] 0.52 sec.
2025-09-09 14:48:20 01586_columns_pruning: [ OK ] 0.47 sec.
2025-09-09 14:48:20 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.52 sec.
2025-09-09 14:48:20 01323_if_with_nulls: [ OK ] 0.57 sec.
2025-09-09 14:48:20 01080_window_view_inner_table_memory_hop: [ OK ] 2.57 sec.
2025-09-09 14:48:20 02967_index_hint_crash: [ OK ] 0.37 sec.
2025-09-09 14:48:21 00647_multiply_aggregation_state: [ OK ] 0.47 sec.
2025-09-09 14:48:21 01791_dist_INSERT_block_structure_mismatch: [ OK ] 0.92 sec.
2025-09-09 14:48:21 03093_with_fill_support_constant_expression: [ OK ] 0.32 sec.
2025-09-09 14:48:21 01052_array_reduce_exception: [ OK ] 0.32 sec.
2025-09-09 14:48:21 02751_text_formats_bad_nullable_parsing: [ OK ] 2.72 sec.
2025-09-09 14:48:21 00687_insert_into_mv: [ OK ] 0.57 sec.
2025-09-09 14:48:22 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.37 sec.
2025-09-09 14:48:22 02915_fpc_overflow: [ OK ] 0.87 sec.
2025-09-09 14:48:22 01766_todatetime64_no_timezone_arg: [ OK ] 0.32 sec.
2025-09-09 14:48:22 00545_weird_aggregate_functions: [ OK ] 0.32 sec.
2025-09-09 14:48:22 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.68 sec.
2025-09-09 14:48:23 02160_client_autocomplete_parse_query: [ OK ] 1.97 sec.
2025-09-09 14:48:23 00534_functions_bad_arguments4_long: [ SKIPPED ] 0.00 sec.
2025-09-09 14:48:23 Reason: not running for current build
2025-09-09 14:48:23 02345_analyzer_subqueries: [ OK ] 0.47 sec.
2025-09-09 14:48:23 02916_distributed_skip_unavailable_shards: [ OK ] 0.47 sec.
2025-09-09 14:48:23 02579_parameterized_replace: [ OK ] 0.37 sec.
2025-09-09 14:48:24 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 0.83 sec.
2025-09-09 14:48:24 03038_nested_dynamic_merges_wide_vertical: [ OK ] 2.87 sec.
2025-09-09 14:48:24 01010_partial_merge_join: [ OK ] 1.37 sec.
2025-09-09 14:48:24 02832_transform_fixed_string_no_default: [ OK ] 0.32 sec.
2025-09-09 14:48:24 00266_read_overflow_mode: [ OK ] 0.32 sec.
2025-09-09 14:48:24 02418_keeper_map_keys_limit: [ OK ] 0.47 sec.
2025-09-09 14:48:25 02706_kolmogorov_smirnov_test: [ OK ] 0.53 sec.
2025-09-09 14:48:25 00028_shard_big_agg_aj_distributed: [ OK ] 0.47 sec.
2025-09-09 14:48:25 01891_not_like_partition_prune: [ OK ] 0.72 sec.
2025-09-09 14:48:25 02481_async_insert_dedup: [ OK ] 90.20 sec.
2025-09-09 14:48:25 01651_lc_insert_tiny_log_3: [ OK ] 3.73 sec.
2025-09-09 14:48:26 02675_predicate_push_down_filled_join_fix: [ OK ] 0.42 sec.
2025-09-09 14:48:26 01881_to_week_monotonic_fix: [ OK ] 0.37 sec.
2025-09-09 14:48:26 02811_insert_schema_inference: [ OK ] 0.32 sec.
2025-09-09 14:48:26 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 10.24 sec.
2025-09-09 14:48:27 02149_schema_inference_formats_with_schema_3: [ OK ] 2.52 sec.
2025-09-09 14:48:27 02884_parquet_new_encodings: [ OK ] 0.77 sec.
2025-09-09 14:48:27 03006_async_insert_deadlock_log: [ OK ] 1.82 sec.
2025-09-09 14:48:27 01085_extract_all_empty: [ OK ] 0.32 sec.
2025-09-09 14:48:27 02500_bson_read_object_id: [ OK ] 0.87 sec.
2025-09-09 14:48:27 03041_select_with_query_result: [ OK ] 0.42 sec.
2025-09-09 14:48:27 02563_async_insert_bad_data: [ OK ] 1.72 sec.
2025-09-09 14:48:27 00753_quantile_format: [ OK ] 0.42 sec.
2025-09-09 14:48:28 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.42 sec.
2025-09-09 14:48:28 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec.
2025-09-09 14:48:28 Reason: not running for current build
2025-09-09 14:48:28 01736_null_as_default: [ OK ] 0.32 sec.
2025-09-09 14:48:28 01925_map_populate_series_on_map: [ OK ] 0.57 sec.
2025-09-09 14:48:28 00148_summing_merge_tree_aggregate_function: [ OK ] 1.87 sec.
2025-09-09 14:48:28 02588_avro_date32_and_decimals: [ OK ] 1.52 sec.
2025-09-09 14:48:28 00453_cast_enum: [ OK ] 0.42 sec.
2025-09-09 14:48:29 03147_asof_join_ddb_missing: [ OK ] 1.62 sec.
2025-09-09 14:48:29 00936_substring_utf8_non_const: [ OK ] 1.77 sec.
2025-09-09 14:48:29 01509_dictionary_preallocate: [ OK ] 0.92 sec.
2025-09-09 14:48:29 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.77 sec.
2025-09-09 14:48:30 01283_strict_resize_bug: [ OK ] 0.72 sec.
2025-09-09 14:48:30 02681_comparsion_tuple_elimination_ast: [ OK ] 0.37 sec.
2025-09-09 14:48:30 02941_variant_type_2: [ OK ] 9.39 sec.
2025-09-09 14:48:30 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.32 sec.
2025-09-09 14:48:30 01825_new_type_json_18: [ OK ] 0.32 sec.
2025-09-09 14:48:31 00825_protobuf_format_skipped_column_in_nested: [ OK ] 2.02 sec.
2025-09-09 14:48:31 02874_toDaysSinceYearZero: [ OK ] 0.47 sec.
2025-09-09 14:48:31 03003_count_asterisk_filter: [ OK ] 0.37 sec.
2025-09-09 14:48:31 02533_generate_random_schema_inference: [ OK ] 0.37 sec.
2025-09-09 14:48:32 00978_sum_map_bugfix: [ OK ] 0.37 sec.
2025-09-09 14:48:32 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 1.27 sec.
2025-09-09 14:48:32 01664_array_slice_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:48:32 00700_decimal_aggregates: [ OK ] 1.07 sec.
2025-09-09 14:48:32 02382_analyzer_matcher_join_using: [ OK ] 0.57 sec.
2025-09-09 14:48:32 01605_skip_idx_compact_parts: [ OK ] 0.42 sec.
2025-09-09 14:48:32 02115_write_buffers_finalize: [ OK ] 9.29 sec.
2025-09-09 14:48:33 03352_distinct_sorted_bug: [ OK ] 0.37 sec.
2025-09-09 14:48:33 02422_read_numbers_as_strings: [ OK ] 0.32 sec.
2025-09-09 14:48:33 02478_window_frame_type_groups: [ OK ] 0.37 sec.
2025-09-09 14:48:33 00556_array_intersect: [ OK ] 0.42 sec.
2025-09-09 14:48:33 01416_join_totals_header_bug: [ OK ] 0.37 sec.
2025-09-09 14:48:33 00502_sum_map: [ OK ] 0.52 sec.
2025-09-09 14:48:33 00320_between: [ OK ] 0.32 sec.
2025-09-09 14:48:33 01082_bit_test_out_of_bound: [ OK ] 0.52 sec.
2025-09-09 14:48:34 01871_merge_tree_compile_expressions: [ OK ] 0.77 sec.
2025-09-09 14:48:34 01505_trivial_count_with_partition_predicate: [ OK ] 0.52 sec.
2025-09-09 14:48:34 01050_engine_join_crash: [ OK ] 0.47 sec.
2025-09-09 14:48:35 03164_adapting_parquet_reader_output_size: [ OK ] 1.07 sec.
2025-09-09 14:48:35 02477_age_datetime64: [ OK ] 0.57 sec.
2025-09-09 14:48:35 02911_system_symbols: [ OK ] 0.82 sec.
2025-09-09 14:48:35 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.37 sec.
2025-09-09 14:48:35 02122_join_group_by_timeout: [ OK ] 6.68 sec.
2025-09-09 14:48:35 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 2.33 sec.
2025-09-09 14:48:35 03142_alter_comment_parameterized_view: [ OK ] 0.32 sec.
2025-09-09 14:48:35 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.52 sec.
2025-09-09 14:48:35 02336_sort_optimization_with_fill: [ OK ] 0.32 sec.
2025-09-09 14:48:35 00714_alter_uuid: [ OK ] 0.47 sec.
2025-09-09 14:48:35 00538_datediff_plural_units: [ OK ] 0.42 sec.
2025-09-09 14:48:36 00569_parse_date_time_best_effort: [ OK ] 0.37 sec.
2025-09-09 14:48:36 00476_pretty_formats_and_widths: [ OK ] 0.47 sec.
2025-09-09 14:48:36 00848_join_use_nulls_segfault: [ OK ] 0.57 sec.
2025-09-09 14:48:37 00431_if_nulls: [ OK ] 1.07 sec.
2025-09-09 14:48:37 00688_low_cardinality_dictionary_deserialization: [ OK ] 1.07 sec.
2025-09-09 14:48:37 00668_compare_arrays_silviucpp: [ OK ] 0.32 sec.
2025-09-09 14:48:37 03156_group_concat: [ OK ] 0.77 sec.
2025-09-09 14:48:37 00136_duplicate_order_by_elems: [ OK ] 0.37 sec.
2025-09-09 14:48:37 01273_arrow_decimal: [ OK ] 2.33 sec.
2025-09-09 14:48:38 03148_asof_join_ddb_subquery: [ OK ] 0.42 sec.
2025-09-09 14:48:38 00346_if_tuple: [ OK ] 0.37 sec.
2025-09-09 14:48:38 02250_lots_of_columns_in_csv_with_names: [ OK ] 2.02 sec.
2025-09-09 14:48:38 00943_mv_rename_without_inner_table: [ OK ] 0.37 sec.
2025-09-09 14:48:38 01772_to_start_of_hour_align: [ OK ] 0.42 sec.
2025-09-09 14:48:38 02835_join_step_explain: [ OK ] 0.47 sec.
2025-09-09 14:48:38 01079_new_range_reader_segfault: [ OK ] 0.37 sec.
2025-09-09 14:48:39 03004_force_null_for_omitted: [ OK ] 0.62 sec.
2025-09-09 14:48:39 02922_respect_nulls_Nullable: [ OK ] 0.47 sec.
2025-09-09 14:48:40 02032_short_circuit_least_greatest_bug: [ OK ] 0.32 sec.
2025-09-09 14:48:40 00900_null_array_orc_load: [ OK ] 2.12 sec.
2025-09-09 14:48:41 00411_long_accurate_number_comparison_int2: [ OK ] 11.85 sec.
2025-09-09 14:48:41 02973_dictionary_table_exception_fix: [ OK ] 0.32 sec.
2025-09-09 14:48:41 02025_storage_filelog_virtual_col: [ OK ] 4.88 sec.
2025-09-09 14:48:41 03208_numbers_total_rows_approx: [ OK ] 0.32 sec.
2025-09-09 14:48:41 00287_column_const_with_nan: [ OK ] 0.32 sec.
2025-09-09 14:48:41 01785_parallel_formatting_memory: [ OK ] 1.53 sec.
2025-09-09 14:48:42 00723_remerge_sort: [ OK ] 0.57 sec.
2025-09-09 14:48:42 00986_materialized_view_stack_overflow: [ OK ] 0.87 sec.
2025-09-09 14:48:42 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 4.13 sec.
2025-09-09 14:48:42 02274_full_sort_join_nodistinct: [ OK ] 3.88 sec.
2025-09-09 14:48:42 01470_test_insert_select_asterisk: [ OK ] 0.42 sec.
2025-09-09 14:48:42 01825_type_json_partitions: [ OK ] 0.37 sec.
2025-09-09 14:48:42 01710_projection_with_ast_rewrite_settings: [ OK ] 0.47 sec.
2025-09-09 14:48:43 01338_long_select_and_alter_zookeeper: [ OK ] 14.00 sec.
2025-09-09 14:48:43 02864_statistics_ddl: [ OK ] 1.57 sec.
2025-09-09 14:48:43 02811_invalid_embedded_rocksdb_create: [ OK ] 0.52 sec.
2025-09-09 14:48:43 01018_Distributed__shard_num: [ OK ] 0.72 sec.
2025-09-09 14:48:43 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.42 sec.
2025-09-09 14:48:43 02883_array_scalar_mult_div_modulo: [ OK ] 0.52 sec.
2025-09-09 14:48:43 02835_fuzz_remove_redundant_sorting: [ OK ] 0.47 sec.
2025-09-09 14:48:44 02524_fuzz_and_fuss: [ OK ] 0.37 sec.
2025-09-09 14:48:44 02903_bug_43644: [ OK ] 0.32 sec.
2025-09-09 14:48:44 01851_clear_column_referenced_by_mv: [ OK ] 0.42 sec.
2025-09-09 14:48:44 01676_range_hashed_dictionary: [ OK ] 0.62 sec.
2025-09-09 14:48:44 01281_parseDateTime64BestEffort: [ OK ] 0.83 sec.
2025-09-09 14:48:45 02783_date_predicate_optimizations: [ OK ] 1.32 sec.
2025-09-09 14:48:45 03144_asof_join_ddb_doubles: [ OK ] 0.42 sec.
2025-09-09 14:48:45 00882_multiple_join_no_alias: [ OK ] 0.47 sec.
2025-09-09 14:48:45 01770_extended_range_3: [ OK ] 0.32 sec.
2025-09-09 14:48:45 03172_dynamic_binary_serialization: [ OK ] 16.51 sec.
2025-09-09 14:48:45 00619_union_highlite: [ OK ] 0.32 sec.
2025-09-09 14:48:45 01822_union_and_constans_error: [ OK ] 0.37 sec.
2025-09-09 14:48:45 02997_projections_formatting: [ OK ] 0.22 sec.
2025-09-09 14:48:45 01051_aggregate_function_crash: [ OK ] 0.32 sec.
2025-09-09 14:48:45 00353_join_by_tuple: [ OK ] 0.32 sec.
2025-09-09 14:48:45 01825_type_json_1: [ OK ] 0.52 sec.
2025-09-09 14:48:46 02868_operator_is_not_distinct_from_priority: [ OK ] 0.37 sec.
2025-09-09 14:48:46 01182_materialized_view_different_structure: [ OK ] 0.87 sec.
2025-09-09 14:48:46 03005_input_function_in_join: [ OK ] 0.47 sec.
2025-09-09 14:48:46 01710_projection_with_column_transformers: [ OK ] 0.27 sec.
2025-09-09 14:48:47 02813_func_today_and_alias: [ OK ] 0.37 sec.
2025-09-09 14:48:47 01034_values_parse_float_bug: [ OK ] 2.28 sec.
2025-09-09 14:48:47 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.43 sec.
2025-09-09 14:48:47 01470_explain: [ OK ] 0.32 sec.
2025-09-09 14:48:47 03230_anyHeavy_merge: [ OK ] 0.42 sec.
2025-09-09 14:48:48 03053_analyzer_join_alias: [ OK ] 0.37 sec.
2025-09-09 14:48:48 02907_backup_restore_flatten_nested: [ OK ] 2.93 sec.
2025-09-09 14:48:48 02421_simple_queries_for_opentelemetry: [ OK ] 6.08 sec.
2025-09-09 14:48:48 02677_analyzer_compound_expressions: [ OK ] 0.57 sec.
2025-09-09 14:48:49 00460_vertical_and_totals_extremes: [ OK ] 0.37 sec.
2025-09-09 14:48:49 01669_test_toYear_mysql_dialect: [ OK ] 0.32 sec.
2025-09-09 14:48:49 01125_dict_ddl_cannot_add_column: [ OK ] 0.33 sec.
2025-09-09 14:48:49 02458_insert_select_progress_tcp: [ OK ] 3.23 sec.
2025-09-09 14:48:49 03325_distributed_join_json_array_subcolumns: [ OK ] 0.47 sec.
2025-09-09 14:48:49 02286_convert_decimal_type: [ OK ] 0.32 sec.
2025-09-09 14:48:49 00916_add_materialized_column_after: [ OK ] 0.32 sec.
2025-09-09 14:48:50 02893_bad_sample_view: [ OK ] 0.32 sec.
2025-09-09 14:48:50 00530_arrays_of_nothing: [ OK ] 0.37 sec.
2025-09-09 14:48:50 02475_analyzer_join_tree_subquery: [ OK ] 0.42 sec.
2025-09-09 14:48:50 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.57 sec.
2025-09-09 14:48:50 01436_storage_merge_with_join_push_down: [ OK ] 0.37 sec.
2025-09-09 14:48:51 02461_alter_update_respect_part_column_type_bug: [ OK ] 2.23 sec.
2025-09-09 14:48:51 00688_low_cardinality_alter_add_column: [ OK ] 0.37 sec.
2025-09-09 14:48:52 02416_json_tuple_to_array_schema_inference: [ OK ] 0.32 sec.
2025-09-09 14:48:52 02798_generic_transform: [ OK ] 0.37 sec.
2025-09-09 14:48:52 01526_initial_query_id: [ OK ] 2.23 sec.
2025-09-09 14:48:52 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec.
2025-09-09 14:48:52 Reason: not running for current build
2025-09-09 14:48:53 02735_array_map_array_of_tuples: [ OK ] 0.42 sec.
2025-09-09 14:48:53 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.82 sec.
2025-09-09 14:48:53 00055_join_two_numbers: [ OK ] 0.37 sec.
2025-09-09 14:48:53 01083_window_view_select: [ OK ] 2.83 sec.
2025-09-09 14:48:53 03107_ill_formed_select_in_materialized_view: [ OK ] 0.37 sec.
2025-09-09 14:48:54 01250_fixed_string_comparison: [ OK ] 0.37 sec.
2025-09-09 14:48:54 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.57 sec.
2025-09-09 14:48:54 02911_arrow_large_list: [ OK ] 0.72 sec.
2025-09-09 14:48:55 02157_readonly_system_suspend: [ OK ] 1.07 sec.
2025-09-09 14:48:55 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.47 sec.
2025-09-09 14:48:56 02181_format_describe_query: [ OK ] 0.77 sec.
2025-09-09 14:48:57 01060_defaults_all_columns: [ OK ] 0.62 sec.
2025-09-09 14:48:58 01507_transform_null_in: [ OK ] 0.58 sec.
2025-09-09 14:48:59 02370_lost_part_intersecting_merges: [ OK ] 17.69 sec.
2025-09-09 14:48:59 02476_analyzer_identifier_hints: [ OK ] 17.09 sec.
2025-09-09 14:48:59 01665_substring_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:48:59 01001_rename_merge_race_condition: [ OK ] 11.96 sec.
2025-09-09 14:48:59 02915_lazy_loading_of_base_backups: [ OK ] 5.39 sec.
2025-09-09 14:48:59 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.52 sec.
2025-09-09 14:49:00 02551_ipv4_implicit_uint64: [ OK ] 0.42 sec.
2025-09-09 14:49:00 02098_date32_comparison: [ OK ] 0.48 sec.
2025-09-09 14:49:00 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.42 sec.
2025-09-09 14:49:00 01456_low_cardinality_sorting_bugfix: [ OK ] 0.52 sec.
2025-09-09 14:49:01 01097_cyclic_defaults: [ OK ] 0.67 sec.
2025-09-09 14:49:01 00550_join_insert_select: [ OK ] 1.27 sec.
2025-09-09 14:49:01 01064_pm_all_join_const_and_nullable: [ OK ] 0.67 sec.
2025-09-09 14:49:02 00836_indices_alter_replicated_zookeeper_long: [ OK ] 1.13 sec.
2025-09-09 14:49:02 02184_ipv6_cast_test: [ OK ] 0.37 sec.
2025-09-09 14:49:02 03161_ipv4_ipv6_equality: [ OK ] 0.32 sec.
2025-09-09 14:49:02 01509_check_many_parallel_quorum_inserts_long: [ OK ] 8.06 sec.
2025-09-09 14:49:02 01825_type_json_ghdata_insert_select: [ OK ] 13.11 sec.
2025-09-09 14:49:02 02154_bitmap_contains: [ OK ] 0.47 sec.
2025-09-09 14:49:02 03146_bug47862: [ OK ] 0.32 sec.
2025-09-09 14:49:02 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.42 sec.
2025-09-09 14:49:03 00917_multiple_joins_denny_crane: [ OK ] 0.42 sec.
2025-09-09 14:49:03 01716_drop_rename_sign_column: [ OK ] 0.57 sec.
2025-09-09 14:49:03 03196_max_intersections_arena_crash: [ OK ] 0.37 sec.
2025-09-09 14:49:03 01384_bloom_filter_bad_arguments: [ OK ] 0.52 sec.
2025-09-09 14:49:03 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 4.19 sec.
2025-09-09 14:49:03 02985_if_over_big_int_decimal: [ OK ] 0.37 sec.
2025-09-09 14:49:04 02002_system_table_with_tuple: [ OK ] 0.87 sec.
2025-09-09 14:49:04 01069_database_memory: [ OK ] 0.32 sec.
2025-09-09 14:49:04 01710_projection_with_nullable_keys: [ OK ] 0.32 sec.
2025-09-09 14:49:04 02357_query_cancellation_race: [ OK ] 6.49 sec.
2025-09-09 14:49:04 01903_http_fields: [ OK ] 1.42 sec.
2025-09-09 14:49:04 00354_host_command_line_option: [ OK ] 1.52 sec.
2025-09-09 14:49:04 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.37 sec.
2025-09-09 14:49:05 00604_show_create_database: [ OK ] 0.42 sec.
2025-09-09 14:49:05 00488_column_name_primary: [ OK ] 0.47 sec.
2025-09-09 14:49:05 02122_4letter_words_stress_zookeeper: [ OK ] 18.78 sec.
2025-09-09 14:49:05 02842_vertical_merge_after_add_drop_column: [ OK ] 0.37 sec.
2025-09-09 14:49:05 01506_buffer_table_alter_block_structure: [ OK ] 0.48 sec.
2025-09-09 14:49:05 02344_distinct_limit_distiributed: [ OK ] 1.03 sec.
2025-09-09 14:49:05 03033_set_index_in: [ OK ] 0.72 sec.
2025-09-09 14:49:05 02950_parallel_replicas_used_count: [ OK ] 1.72 sec.
2025-09-09 14:49:06 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.37 sec.
2025-09-09 14:49:06 02266_auto_add_nullable: [ OK ] 0.37 sec.
2025-09-09 14:49:06 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 0.62 sec.
2025-09-09 14:49:06 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 0.88 sec.
2025-09-09 14:49:07 03456_match_index_prefix_extraction: [ OK ] 0.87 sec.
2025-09-09 14:49:07 02104_clickhouse_local_columns_description: [ OK ] 0.72 sec.
2025-09-09 14:49:07 00215_primary_key_order_zookeeper_long: [ OK ] 0.52 sec.
2025-09-09 14:49:07 03038_recursive_cte_postgres_4: [ OK ] 0.37 sec.
2025-09-09 14:49:07 02046_low_cardinality_parallel_group_by: [ OK ] 4.29 sec.
2025-09-09 14:49:07 00719_insert_block_without_column: [ OK ] 2.23 sec.
2025-09-09 14:49:07 00800_low_cardinality_empty_array: [ OK ] 0.37 sec.
2025-09-09 14:49:07 01942_snowflakeIDToDateTime: [ OK ] 0.57 sec.
2025-09-09 14:49:07 02990_format_not_precedence: [ OK ] 0.32 sec.
2025-09-09 14:49:07 01825_type_json_13: [ OK ] 2.63 sec.
2025-09-09 14:49:07 00619_extract: [ OK ] 0.37 sec.
2025-09-09 14:49:07 01614_with_fill_with_limit: [ OK ] 0.32 sec.
2025-09-09 14:49:08 02455_extract_fixed_string_from_nested_json: [ OK ] 0.32 sec.
2025-09-09 14:49:08 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.42 sec.
2025-09-09 14:49:08 02918_gorilla_invalid_file: [ OK ] 0.62 sec.
2025-09-09 14:49:08 01102_distributed_local_in_bug: [ OK ] 0.42 sec.
2025-09-09 14:49:08 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 0.52 sec.
2025-09-09 14:49:08 00064_negate_bug: [ OK ] 0.32 sec.
2025-09-09 14:49:08 02454_compressed_marks_in_compact_part: [ OK ] 0.37 sec.
2025-09-09 14:49:08 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.47 sec.
2025-09-09 14:49:08 00875_join_right_nulls_ors: [ OK ] 0.47 sec.
2025-09-09 14:49:08 02294_system_certificates: [ OK ] 0.32 sec.
2025-09-09 14:49:09 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.42 sec.
2025-09-09 14:49:09 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.32 sec.
2025-09-09 14:49:09 02007_join_use_nulls: [ OK ] 0.37 sec.
2025-09-09 14:49:09 02933_ephemeral_mv: [ OK ] 0.37 sec.
2025-09-09 14:49:09 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.32 sec.
2025-09-09 14:49:09 01431_utf8_ubsan: [ OK ] 0.37 sec.
2025-09-09 14:49:09 02790_url_multiple_tsv_files: [ OK ] 0.97 sec.
2025-09-09 14:49:09 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.42 sec.
2025-09-09 14:49:09 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.32 sec.
2025-09-09 14:49:09 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.57 sec.
2025-09-09 14:49:09 01951_distributed_push_down_limit: [ OK ] 0.37 sec.
2025-09-09 14:49:09 01868_order_by_fill_with_datetime64: [ OK ] 0.37 sec.
2025-09-09 14:49:10 03048_not_found_column_xxx_in_block: [ OK ] 0.37 sec.
2025-09-09 14:49:10 00940_max_parts_in_total: [ OK ] 0.42 sec.
2025-09-09 14:49:10 00725_join_on_bug_3: [ OK ] 0.37 sec.
2025-09-09 14:49:10 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.42 sec.
2025-09-09 14:49:10 03014_window_view_crash: [ OK ] 0.32 sec.
2025-09-09 14:49:10 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 4.13 sec.
2025-09-09 14:49:10 01446_json_strings_each_row: [ OK ] 9.09 sec.
2025-09-09 14:49:10 00823_sequence_match_dfa: [ OK ] 1.22 sec.
2025-09-09 14:49:10 01120_join_constants: [ OK ] 0.37 sec.
2025-09-09 14:49:10 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.32 sec.
2025-09-09 14:49:10 02021_map_bloom_filter_index: [ OK ] 0.72 sec.
2025-09-09 14:49:10 02325_compatibility_setting_2: [ OK ] 0.42 sec.
2025-09-09 14:49:11 01074_h3_range_check: [ OK ] 0.42 sec.
2025-09-09 14:49:11 01802_formatDateTime_DateTime64_century: [ OK ] 0.52 sec.
2025-09-09 14:49:11 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.47 sec.
2025-09-09 14:49:11 00753_distributed_system_columns_and_system_tables: [ OK ] 0.42 sec.
2025-09-09 14:49:11 02021_prewhere_column_optimization: [ OK ] 0.42 sec.
2025-09-09 14:49:11 02554_invalid_create_view_syntax: [ OK ] 0.32 sec.
2025-09-09 14:49:11 02368_analyzer_table_functions: [ OK ] 0.42 sec.
2025-09-09 14:49:11 01813_quantileBfloat16_nans: [ OK ] 0.37 sec.
2025-09-09 14:49:11 03018_external_with_complex_data_types: [ OK ] 0.87 sec.
2025-09-09 14:49:11 02477_exists_fuzz_43478: [ OK ] 0.32 sec.
2025-09-09 14:49:11 02915_analyzer_fuzz_2: [ OK ] 0.32 sec.
2025-09-09 14:49:11 02731_nothing_deserialization: [ OK ] 0.42 sec.
2025-09-09 14:49:11 00841_temporary_table_database: [ OK ] 0.37 sec.
2025-09-09 14:49:12 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.47 sec.
2025-09-09 14:49:12 02559_add_parts: [ OK ] 0.42 sec.
2025-09-09 14:49:12 03243_create_or_replace_view_dependency_check: [ OK ] 0.37 sec.
2025-09-09 14:49:12 02516_projections_with_rollup: [ OK ] 1.97 sec.
2025-09-09 14:49:12 02245_s3_virtual_columns: [ OK ] 0.42 sec.
2025-09-09 14:49:12 01093_cyclic_defaults_filimonov: [ OK ] 0.37 sec.
2025-09-09 14:49:12 01072_json_each_row_data_in_square_brackets: [ OK ] 0.32 sec.
2025-09-09 14:49:12 03033_create_as_copies_comment: [ OK ] 0.37 sec.
2025-09-09 14:49:14 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 1.33 sec.
2025-09-09 14:49:15 02383_array_signed_const_positive_index: [ OK ] 0.69 sec.
2025-09-09 14:49:15 02225_hints_for_indeices: [ OK ] 3.43 sec.
2025-09-09 14:49:15 00937_format_schema_rows_template: [ OK ] 4.54 sec.
2025-09-09 14:49:16 02891_rename_table_without_keyword: [ OK ] 0.79 sec.
2025-09-09 14:49:16 01527_bad_aggregation_in_lambda: [ OK ] 0.44 sec.
2025-09-09 14:49:17 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 1.09 sec.
2025-09-09 14:49:18 01475_read_subcolumns_3: [ OK ] 0.94 sec.
2025-09-09 14:49:19 01246_extractAllGroupsVertical: [ OK ] 0.85 sec.
2025-09-09 14:49:19 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.42 sec.
2025-09-09 14:49:20 01514_parallel_formatting: [ OK ] 4.32 sec.
2025-09-09 14:49:20 01084_regexp_empty: [ OK ] 0.58 sec.
2025-09-09 14:49:20 01523_client_local_queries_file_parameter: [ OK ] 3.50 sec.
2025-09-09 14:49:20 02482_execute_functions_before_sorting_bug: [ OK ] 0.54 sec.
2025-09-09 14:49:21 00902_entropy: [ OK ] 0.69 sec.
2025-09-09 14:49:21 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.58 sec.
2025-09-09 14:49:22 03208_inconsistent_formatting_of_not_subquery: [ OK ] 1.29 sec.
2025-09-09 14:49:22 01073_show_tables_not_like: [ OK ] 0.68 sec.
2025-09-09 14:49:22 00369_int_div_of_float: [ OK ] 0.63 sec.
2025-09-09 14:49:23 01710_normal_projections: [ OK ] 10.76 sec.
2025-09-09 14:49:24 01017_uniqCombined_memory_usage: [ OK ] 1.48 sec.
2025-09-09 14:49:24 02346_read_in_order_fixed_prefix: [ OK ] 12.42 sec.
2025-09-09 14:49:25 02374_analyzer_join_using: [ OK ] 2.54 sec.
2025-09-09 14:49:25 00196_float32_formatting: [ OK ] 0.49 sec.
2025-09-09 14:49:25 02456_alter-nullable-column-bag: [ OK ] 0.75 sec.
2025-09-09 14:49:25 01115_prewhere_array_join: [ OK ] 1.03 sec.
2025-09-09 14:49:26 01220_scalar_optimization_in_alter: [ OK ] 0.44 sec.
2025-09-09 14:49:26 00909_arrayEnumerateUniq: [ OK ] 3.31 sec.
2025-09-09 14:49:26 03041_dynamic_type_check_table: [ OK ] 13.89 sec.
2025-09-09 14:49:26 03010_view_prewhere_in: [ OK ] 0.48 sec.
2025-09-09 14:49:26 02560_window_ntile: [ OK ] 1.10 sec.
2025-09-09 14:49:26 03034_recursive_cte_tree: [ OK ] 0.53 sec.
2025-09-09 14:49:27 00730_unicode_terminal_format: [ OK ] 0.63 sec.
2025-09-09 14:49:27 02737_arrayJaccardIndex: [ OK ] 0.82 sec.
2025-09-09 14:49:27 00753_alter_destination_for_storage_buffer: [ OK ] 0.70 sec.
2025-09-09 14:49:27 02582_async_reading_with_small_limit: [ OK ] 0.43 sec.
2025-09-09 14:49:27 03209_parameterized_view_with_non_literal_params: [ OK ] 1.26 sec.
2025-09-09 14:49:28 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.74 sec.
2025-09-09 14:49:28 01599_multiline_input_and_singleline_comments: [ OK ] 1.24 sec.
2025-09-09 14:49:29 02415_all_new_functions_must_be_documented: [ OK ] 0.44 sec.
2025-09-09 14:49:29 02884_duplicate_index_name: [ OK ] 0.54 sec.
2025-09-09 14:49:29 00324_hashing_enums: [ OK ] 0.64 sec.
2025-09-09 14:49:30 02148_cast_type_parsing: [ OK ] 0.48 sec.
2025-09-09 14:49:30 01106_const_fixed_string_like: [ OK ] 0.72 sec.
2025-09-09 14:49:31 01359_geodistance_loop: [ OK ] 0.58 sec.
2025-09-09 14:49:31 00109_shard_totals_after_having: [ OK ] 1.53 sec.
2025-09-09 14:49:32 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.53 sec.
2025-09-09 14:49:32 02764_csv_trim_whitespaces: [ OK ] 25.13 sec.
2025-09-09 14:49:33 01825_type_json_schema_inference: [ OK ] 6.02 sec.
2025-09-09 14:49:33 02553_type_object_analyzer: [ OK ] 0.58 sec.
2025-09-09 14:49:33 02833_tuple_concat: [ OK ] 0.68 sec.
2025-09-09 14:49:33 01514_input_format_json_enum_as_number: [ OK ] 0.43 sec.
2025-09-09 14:49:33 02841_tuple_modulo: [ OK ] 0.53 sec.
2025-09-09 14:49:34 02383_schema_inference_hints: [ OK ] 0.38 sec.
2025-09-09 14:49:34 00834_not_between: [ OK ] 0.38 sec.
2025-09-09 14:49:35 02842_table_function_file_filter_by_virtual_columns: [ OK ] 1.84 sec.
2025-09-09 14:49:35 01889_check_row_policy_defined_using_user_function: [ OK ] 8.11 sec.
2025-09-09 14:49:36 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.62 sec.
2025-09-09 14:49:36 01278_variance_nonnegative: [ OK ] 0.88 sec.
2025-09-09 14:49:37 01545_url_file_format_settings: [ OK ] 0.75 sec.
2025-09-09 14:49:39 02817_structure_to_schema: [ OK ] 19.33 sec.
2025-09-09 14:49:40 01946_profile_sleep: [ OK ] 2.30 sec.
2025-09-09 14:49:40 02134_async_inserts_formats: [ OK ] 8.68 sec.
2025-09-09 14:49:40 00527_totals_having_nullable: [ OK ] 0.53 sec.
2025-09-09 14:49:43 03153_format_regexp_usability: [ OK ] 2.81 sec.
2025-09-09 14:49:44 02883_zookeeper_finalize_stress: [ OK ] 11.76 sec.
2025-09-09 14:49:45 01784_parallel_formatting_memory: [ OK ] 0.42 sec.
2025-09-09 14:49:45 01529_bad_memory_tracking: [ OK ] 4.66 sec.
2025-09-09 14:49:45 02890_untuple_column_names: [ OK ] 0.55 sec.
2025-09-09 14:49:46 00568_empty_function_with_fixed_string: [ OK ] 0.52 sec.
2025-09-09 14:49:46 02907_clickhouse_dictionary_bug: [ OK ] 3.35 sec.
2025-09-09 14:49:46 00804_test_alter_compression_codecs: [ OK ] 11.89 sec.
2025-09-09 14:49:46 00991_system_parts_race_condition_long: [ OK ] 34.68 sec.
2025-09-09 14:49:46 00422_hash_function_constexpr: [ OK ] 0.32 sec.
2025-09-09 14:49:46 01678_great_circle_angle: [ OK ] 0.33 sec.
2025-09-09 14:49:47 02535_ip_parser_not_whole: [ OK ] 0.37 sec.
2025-09-09 14:49:47 03289_explain_syntax_statistics: [ OK ] 0.37 sec.
2025-09-09 14:49:47 02517_avro_bool_type: [ OK ] 0.83 sec.
2025-09-09 14:49:47 00600_create_temporary_table_if_not_exists: [ OK ] 0.32 sec.
2025-09-09 14:49:47 02880_indexHint__partition_id: [ OK ] 0.37 sec.
2025-09-09 14:49:47 00653_verification_monotonic_data_load: [ OK ] 20.43 sec.
2025-09-09 14:49:47 03299_deep_nested_map_creation: [ OK ] 0.32 sec.
2025-09-09 14:49:47 02968_analyzer_join_column_not_found: [ OK ] 0.32 sec.
2025-09-09 14:49:47 00118_storage_join: [ OK ] 0.37 sec.
2025-09-09 14:49:47 01273_arrow_nullable_arrays_load: [ OK ] 2.52 sec.
2025-09-09 14:49:48 02125_dict_get_type_nullable_fix: [ OK ] 0.37 sec.
2025-09-09 14:49:48 02950_part_log_bytes_uncompressed: [ OK ] 0.42 sec.
2025-09-09 14:49:48 02050_clickhouse_local_parsing_exception: [ OK ] 0.67 sec.
2025-09-09 14:49:48 01632_tinylog_read_write: [ OK ] 11.99 sec.
2025-09-09 14:49:48 02487_create_index_normalize_functions: [ OK ] 0.42 sec.
2025-09-09 14:49:49 02813_seriesOutliersDetectTukey: [ OK ] 0.47 sec.
2025-09-09 14:49:49 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.32 sec.
2025-09-09 14:49:49 00901_joint_entropy: [ OK ] 0.37 sec.
2025-09-09 14:49:49 02833_url_without_path_encoding: [ OK ] 1.17 sec.
2025-09-09 14:49:49 00936_function_result_with_operator_in: [ OK ] 0.42 sec.
2025-09-09 14:49:49 00927_disable_hyperscan: [ OK ] 0.47 sec.
2025-09-09 14:49:49 02764_index_analysis_fix: [ OK ] 0.32 sec.
2025-09-09 14:49:49 02886_missed_json_subcolumns: [ OK ] 0.47 sec.
2025-09-09 14:49:50 02581_width_bucket: [ OK ] 0.62 sec.
2025-09-09 14:49:50 01079_bit_operations_using_bitset: [ OK ] 0.42 sec.
2025-09-09 14:49:50 02439_merge_selecting_partitions: [ OK ] 4.18 sec.
2025-09-09 14:49:50 01326_hostname_alias: [ OK ] 0.37 sec.
2025-09-09 14:49:50 00402_nan_and_extremes: [ OK ] 0.32 sec.
2025-09-09 14:49:51 01249_flush_interactive: [ OK ] 11.45 sec.
2025-09-09 14:49:51 02560_count_digits: [ OK ] 0.37 sec.
2025-09-09 14:49:51 03205_json_syntax: [ OK ] 0.47 sec.
2025-09-09 14:49:51 03003_database_filesystem_format_detection: [ OK ] 1.42 sec.
2025-09-09 14:49:51 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.42 sec.
2025-09-09 14:49:51 02875_json_array_as_string: [ OK ] 0.42 sec.
2025-09-09 14:49:51 01081_demangle: [ OK ] 0.32 sec.
2025-09-09 14:49:52 01333_select_abc_asterisk: [ OK ] 0.37 sec.
2025-09-09 14:49:52 01015_empty_in_inner_right_join: [ OK ] 0.57 sec.
2025-09-09 14:49:52 00980_zookeeper_merge_tree_alter_settings: [ OK ] 0.72 sec.
2025-09-09 14:49:52 02343_group_by_use_nulls: [ OK ] 0.62 sec.
2025-09-09 14:49:52 00612_union_query_with_subquery: [ OK ] 0.37 sec.
2025-09-09 14:49:52 00700_decimal_in_keys: [ OK ] 0.62 sec.
2025-09-09 14:49:53 00803_odbc_driver_2_format: [ OK ] 0.32 sec.
2025-09-09 14:49:53 02476_query_parameters_without_serialisation: [ OK ] 0.42 sec.
2025-09-09 14:49:53 02027_ngrams: [ OK ] 0.62 sec.
2025-09-09 14:49:53 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.42 sec.
2025-09-09 14:49:53 01762_deltasumtimestamp: [ OK ] 0.37 sec.
2025-09-09 14:49:53 02306_rowbinary_has_no_bom: [ OK ] 0.62 sec.
2025-09-09 14:49:54 00143_number_classification_functions: [ OK ] 0.42 sec.
2025-09-09 14:49:54 02047_log_family_data_file_sizes: [ OK ] 7.14 sec.
2025-09-09 14:49:54 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ OK ] 4.54 sec.
2025-09-09 14:49:55 02366_kql_summarize: [ OK ] 0.72 sec.
2025-09-09 14:49:55 00102_insert_into_temporary_table: [ OK ] 0.32 sec.
2025-09-09 14:49:55 02699_polygons_sym_difference_total: [ OK ] 0.32 sec.
2025-09-09 14:49:55 02381_compress_marks_and_primary_key: [ OK ] 1.67 sec.
2025-09-09 14:49:56 02834_timestamp_function: [ OK ] 0.42 sec.
2025-09-09 14:49:56 02476_fix_cast_parser_bug: [ OK ] 0.27 sec.
2025-09-09 14:49:56 01474_custom_null_tsv: [ OK ] 1.87 sec.
2025-09-09 14:49:56 02006_use_constants_in_with_and_select: [ OK ] 0.32 sec.
2025-09-09 14:49:56 00041_aggregation_remap: [ OK ] 0.37 sec.
2025-09-09 14:49:56 01660_second_extremes_bug: [ OK ] 0.32 sec.
2025-09-09 14:49:57 02181_dictionary_attach_detach: [ OK ] 0.42 sec.
2025-09-09 14:49:57 00232_format_readable_decimal_size: [ OK ] 0.32 sec.
2025-09-09 14:49:57 03210_dynamic_squashing: [ OK ] 0.67 sec.
2025-09-09 14:49:57 00639_startsWith: [ OK ] 0.37 sec.
2025-09-09 14:49:59 03134_positional_arguments: [ OK ] 2.02 sec.
2025-09-09 14:49:59 01945_show_debug_warning: [ OK ] 2.47 sec.
2025-09-09 14:49:59 01715_background_checker_blather_zookeeper_long: [ OK ] 10.49 sec.
2025-09-09 14:49:59 00141_parse_timestamp_as_datetime: [ OK ] 0.32 sec.
2025-09-09 14:49:59 01379_with_fill_several_columns: [ OK ] 0.37 sec.
2025-09-09 14:50:00 03032_variant_bool_number_not_suspicious: [ OK ] 0.32 sec.
2025-09-09 14:50:00 01658_values_ubsan: [ OK ] 0.37 sec.
2025-09-09 14:50:00 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 6.99 sec.
2025-09-09 14:50:00 03246_json_tuple_decompress_race: [ OK ] 0.62 sec.
2025-09-09 14:50:01 02966_nested_offsets_subcolumn: [ OK ] 0.97 sec.
2025-09-09 14:50:01 01125_generate_random_qoega: [ OK ] 0.62 sec.
2025-09-09 14:50:01 02100_now64_types_bug: [ OK ] 0.37 sec.
2025-09-09 14:50:01 02016_summing_mt_aggregating_column: [ OK ] 0.37 sec.
2025-09-09 14:50:01 02246_flatten_tuple: [ OK ] 0.37 sec.
2025-09-09 14:50:01 00204_extract_url_parameter: [ OK ] 0.32 sec.
2025-09-09 14:50:01 00098_shard_i_union_all: [ OK ] 0.42 sec.
2025-09-09 14:50:01 00800_function_java_hash: [ OK ] 0.42 sec.
2025-09-09 14:50:02 01014_format_custom_separated: [ OK ] 2.93 sec.
2025-09-09 14:50:02 01552_dict_fixedstring: [ OK ] 0.42 sec.
2025-09-09 14:50:02 02355_column_type_name_lc: [ OK ] 0.32 sec.
2025-09-09 14:50:02 02124_encrypt_decrypt_nullable: [ OK ] 0.42 sec.
2025-09-09 14:50:02 02024_create_dictionary_with_comment: [ OK ] 0.27 sec.
2025-09-09 14:50:02 00520_http_nullable: [ OK ] 0.67 sec.
2025-09-09 14:50:02 02724_persist_interval_type: [ OK ] 0.42 sec.
2025-09-09 14:50:03 01660_join_or_inner: [ OK ] 0.47 sec.
2025-09-09 14:50:03 01526_param_uuid: [ OK ] 0.87 sec.
2025-09-09 14:50:03 00551_parse_or_null: [ OK ] 0.32 sec.
2025-09-09 14:50:03 00910_crash_when_distributed_modify_order_by: [ OK ] 0.37 sec.
2025-09-09 14:50:04 01906_partition_by_multiply_by_zero: [ OK ] 0.37 sec.
2025-09-09 14:50:04 03214_count_distinct_null_key_memory_leak: [ OK ] 2.22 sec.
2025-09-09 14:50:04 02661_read_from_archive_tar: [ OK ] 10.64 sec.
2025-09-09 14:50:04 02812_pointwise_array_operations: [ OK ] 0.47 sec.
2025-09-09 14:50:04 01492_array_join_crash_13829: [ OK ] 0.37 sec.
2025-09-09 14:50:04 01548_with_totals_having: [ OK ] 0.32 sec.
2025-09-09 14:50:04 02242_throw_if_constant_argument: [ OK ] 0.32 sec.
2025-09-09 14:50:04 02890_partition_prune_in_extra_columns: [ OK ] 0.42 sec.
2025-09-09 14:50:05 02311_create_table_with_unknown_format: [ OK ] 0.37 sec.
2025-09-09 14:50:05 02482_insert_into_dist_race: [ OK ] 0.42 sec.
2025-09-09 14:50:05 01582_distinct_subquery_groupby: [ OK ] 0.42 sec.
2025-09-09 14:50:05 01780_column_sparse_distinct: [ OK ] 0.37 sec.
2025-09-09 14:50:05 02392_every_setting_must_have_documentation: [ OK ] 0.32 sec.
2025-09-09 14:50:06 01473_system_events_zeroes: [ OK ] 0.37 sec.
2025-09-09 14:50:06 01276_alter_rename_column_materialized_expr: [ OK ] 0.47 sec.
2025-09-09 14:50:06 01009_insert_select_data_loss: [ OK ] 0.42 sec.
2025-09-09 14:50:06 00360_to_date_from_string_with_datetime: [ OK ] 0.32 sec.
2025-09-09 14:50:07 02324_compatibility_setting: [ OK ] 3.13 sec.
2025-09-09 14:50:07 01083_aggregation_memory_efficient_bug: [ OK ] 0.47 sec.
2025-09-09 14:50:07 03155_explain_current_transaction: [ OK ] 0.32 sec.
2025-09-09 14:50:07 02456_test_zero_copy_mutation: [ OK ] 0.42 sec.
2025-09-09 14:50:07 01416_clear_column_pk: [ OK ] 0.37 sec.
2025-09-09 14:50:07 02433_default_expression_operator_in: [ OK ] 0.47 sec.
2025-09-09 14:50:08 02128_apply_lambda_parsing: [ OK ] 0.32 sec.
2025-09-09 14:50:08 02815_fix_not_found_constants_col_in_block: [ OK ] 0.32 sec.
2025-09-09 14:50:09 00396_uuid: [ OK ] 0.37 sec.
2025-09-09 14:50:09 03148_async_queries_in_query_log_errors: [ OK ] 2.37 sec.
2025-09-09 14:50:09 00443_optimize_final_vertical_merge: [ OK ] 6.43 sec.
2025-09-09 14:50:09 02562_with_fill_nullable: [ OK ] 0.37 sec.
2025-09-09 14:50:09 01269_create_with_null: [ OK ] 0.37 sec.
2025-09-09 14:50:09 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.47 sec.
2025-09-09 14:50:10 01940_totimezone_operator_monotonicity: [ OK ] 0.37 sec.
2025-09-09 14:50:10 02790_client_max_opening_fd: [ OK ] 0.87 sec.
2025-09-09 14:50:10 00974_primary_key_for_lowCardinality: [ OK ] 2.82 sec.
2025-09-09 14:50:10 02192_comment: [ OK ] 0.37 sec.
2025-09-09 14:50:11 01890_state_of_state: [ OK ] 0.57 sec.
2025-09-09 14:50:11 02932_punycode: [ OK ] 0.87 sec.
2025-09-09 14:50:11 03042_not_found_column_c1: [ OK ] 0.32 sec.
2025-09-09 14:50:11 01050_engine_join_view_crash: [ OK ] 0.47 sec.
2025-09-09 14:50:11 01710_projection_array_join: [ OK ] 0.32 sec.
2025-09-09 14:50:11 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.57 sec.
2025-09-09 14:50:12 01289_min_execution_speed_not_too_early: [ OK ] 1.02 sec.
2025-09-09 14:50:12 01056_prepared_statements_null_and_escaping: [ OK ] 0.67 sec.
2025-09-09 14:50:12 03164_analyzer_validate_tree_size: [ OK ] 0.52 sec.
2025-09-09 14:50:13 01070_string_to_h3: [ OK ] 0.47 sec.
2025-09-09 14:50:13 02995_forget_partition: [ OK ] 8.19 sec.
2025-09-09 14:50:13 01071_force_optimize_skip_unused_shards: [ OK ] 0.57 sec.
2025-09-09 14:50:13 02472_segfault_expression_parser: [ OK ] 0.32 sec.
2025-09-09 14:50:13 00800_low_cardinality_distributed_insert: [ OK ] 0.37 sec.
2025-09-09 14:50:13 01409_topK_merge: [ OK ] 0.37 sec.
2025-09-09 14:50:13 01776_decrypt_aead_size_check: [ OK ] 0.37 sec.
2025-09-09 14:50:14 01115_join_with_dictionary: [ OK ] 0.87 sec.
2025-09-09 14:50:14 00676_group_by_in: [ OK ] 0.37 sec.
2025-09-09 14:50:14 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.37 sec.
2025-09-09 14:50:14 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2025-09-09 14:50:14 Reason: not running for current build
2025-09-09 14:50:14 00313_const_totals_extremes: [ OK ] 0.67 sec.
2025-09-09 14:50:15 00263_merge_aggregates_and_overflow: [ OK ] 0.42 sec.
2025-09-09 14:50:15 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.42 sec.
2025-09-09 14:50:15 01098_msgpack_format: [ OK ] 17.91 sec.
2025-09-09 14:50:16 02150_replace_regexp_all_empty_match: [ OK ] 0.37 sec.
2025-09-09 14:50:16 01950_kill_large_group_by_query: [ OK ] 1.77 sec.
2025-09-09 14:50:16 02267_special_operator_parse_alias_check: [ OK ] 0.57 sec.
2025-09-09 14:50:16 02006_client_test_hint_error_name: [ OK ] 0.37 sec.
2025-09-09 14:50:16 02229_client_stop_multiquery_in_SIGINT: [ OK ] 7.03 sec.
2025-09-09 14:50:16 01189_create_as_table_as_table_function: [ OK ] 0.42 sec.
2025-09-09 14:50:16 00169_join_constant_keys: [ OK ] 0.37 sec.
2025-09-09 14:50:16 03262_udf_in_constraint: [ OK ] 0.87 sec.
2025-09-09 14:50:17 02243_make_date32_mysql: [ OK ] 0.42 sec.
2025-09-09 14:50:17 01399_http_request_headers: [ OK ] 0.82 sec.
2025-09-09 14:50:17 00974_adaptive_granularity_secondary_index: [ OK ] 0.87 sec.
2025-09-09 14:50:17 02561_temporary_table_grants: [ OK ] 5.48 sec.
2025-09-09 14:50:17 01131_max_rows_to_sort: [ OK ] 0.37 sec.
2025-09-09 14:50:17 02052_last_granula_adjust_logical_error: [ OK ] 0.67 sec.
2025-09-09 14:50:18 02575_map_hashing_msan: [ OK ] 0.42 sec.
2025-09-09 14:50:18 03140_client_subsequent_external_tables: [ OK ] 0.82 sec.
2025-09-09 14:50:18 03150_dynamic_type_mv_insert: [ OK ] 0.52 sec.
2025-09-09 14:50:18 00997_trim: [ OK ] 0.67 sec.
2025-09-09 14:50:18 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:50:18 00534_functions_bad_arguments7: [ SKIPPED ] 0.00 sec.
2025-09-09 14:50:18 Reason: not running for current build
2025-09-09 14:50:19 00003_reinterpret_as_string: [ OK ] 0.32 sec.
2025-09-09 14:50:19 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2025-09-09 14:50:19 Reason: not running for current build
2025-09-09 14:50:19 00996_limit_with_ties: [ OK ] 0.57 sec.
2025-09-09 14:50:19 02122_parallel_formatting_JSONCompact: [ OK ] 2.17 sec.
2025-09-09 14:50:20 01442_date_time_with_params: [ OK ] 0.92 sec.
2025-09-09 14:50:20 02491_part_log_has_table_uuid: [ OK ] 0.62 sec.
2025-09-09 14:50:20 00609_prewhere_and_default: [ OK ] 0.87 sec.
2025-09-09 14:50:20 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.32 sec.
2025-09-09 14:50:20 01259_combinator_distinct: [ OK ] 0.37 sec.
2025-09-09 14:50:20 01825_type_json_16: [ OK ] 2.48 sec.
2025-09-09 14:50:20 01938_joins_identifiers: [ OK ] 0.37 sec.
2025-09-09 14:50:20 01720_engine_file_empty_if_not_exists: [ OK ] 0.37 sec.
2025-09-09 14:50:21 01773_datetime64_add_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:50:21 01293_show_settings: [ OK ] 0.12 sec.
2025-09-09 14:50:21 02571_local_desc_abort_on_twitter_json: [ OK ] 0.77 sec.
2025-09-09 14:50:21 00626_replace_partition_from_table_zookeeper: [ OK ] 33.26 sec.
2025-09-09 14:50:21 01544_fromModifiedJulianDay: [ OK ] 0.42 sec.
2025-09-09 14:50:21 03131_rewrite_sum_if_nullable: [ OK ] 0.42 sec.
2025-09-09 14:50:21 00082_append_trailing_char_if_absent: [ OK ] 0.32 sec.
2025-09-09 14:50:21 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.37 sec.
2025-09-09 14:50:21 03291_json_big_structure_deserialization: [ OK ] 4.93 sec.
2025-09-09 14:50:21 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 0.77 sec.
2025-09-09 14:50:22 03171_direct_dict_short_circuit_bug: [ OK ] 0.47 sec.
2025-09-09 14:50:22 00462_json_true_false_literals: [ OK ] 0.32 sec.
2025-09-09 14:50:22 02911_add_index_and_materialize_index: [ OK ] 0.32 sec.
2025-09-09 14:50:22 02998_projection_after_attach_partition: [ OK ] 0.47 sec.
2025-09-09 14:50:22 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.32 sec.
2025-09-09 14:50:22 01036_union_different_columns: [ OK ] 0.27 sec.
2025-09-09 14:50:22 02131_skip_index_not_materialized: [ OK ] 0.32 sec.
2025-09-09 14:50:22 01783_merge_engine_join_key_condition: [ OK ] 0.47 sec.
2025-09-09 14:50:22 00593_union_all_assert_columns_removed: [ OK ] 0.37 sec.
2025-09-09 14:50:22 01925_date_date_time_comparison: [ OK ] 0.32 sec.
2025-09-09 14:50:23 01010_pmj_skip_blocks: [ OK ] 0.97 sec.
2025-09-09 14:50:23 02049_clickhouse_local_merge_tree: [ OK ] 0.82 sec.
2025-09-09 14:50:24 03037_union_view: [ OK ] 0.37 sec.
2025-09-09 14:50:24 00507_array_no_params: [ OK ] 1.42 sec.
2025-09-09 14:50:24 02597_projection_materialize_and_replication: [ OK ] 1.37 sec.
2025-09-09 14:50:28 02541_empty_function_support_ip: [ OK ] 4.08 sec.
2025-09-09 14:50:29 00913_many_threads: [ OK ] 5.23 sec.
2025-09-09 14:50:29 02017_bit_shift_left_for_string_integer: [ OK ] 5.23 sec.
2025-09-09 14:50:29 02693_multiple_joins_in: [ OK ] 0.32 sec.
2025-09-09 14:50:29 02354_vector_search_detach_attach: [ OK ] 0.37 sec.
2025-09-09 14:50:29 02995_index_6: [ SKIPPED ] 0.00 sec.
2025-09-09 14:50:29 Reason: not running for current build
2025-09-09 14:50:29 02019_multiple_weird_with_fill: [ OK ] 0.32 sec.
2025-09-09 14:50:30 03215_parsing_archive_name_s3: [ OK ] 0.52 sec.
2025-09-09 14:50:30 01825_type_json_in_array: [ OK ] 0.52 sec.
2025-09-09 14:50:30 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 6.28 sec.
2025-09-09 14:50:30 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.47 sec.
2025-09-09 14:50:30 01662_date_ubsan: [ OK ] 0.62 sec.
2025-09-09 14:50:31 02335_column_ttl_expired_column_optimization: [ OK ] 0.87 sec.
2025-09-09 14:50:31 02911_cte_invalid_query_analysis: [ OK ] 0.37 sec.
2025-09-09 14:50:31 02003_memory_limit_in_client: [ OK ] 10.36 sec.
2025-09-09 14:50:31 01463_resample_overflow: [ OK ] 0.37 sec.
2025-09-09 14:50:31 01633_limit_fuzz: [ OK ] 0.32 sec.
2025-09-09 14:50:31 01663_quantile_weighted_overflow: [ OK ] 0.32 sec.
2025-09-09 14:50:31 03144_invalid_filter: [ OK ] 0.37 sec.
2025-09-09 14:50:31 02412_nlp: [ OK ] 0.42 sec.
2025-09-09 14:50:32 02568_json_array_length: [ OK ] 0.37 sec.
2025-09-09 14:50:32 02251_alter_enum_nested_struct: [ OK ] 0.37 sec.
2025-09-09 14:50:32 01559_misplaced_codec_diagnostics: [ OK ] 0.27 sec.
2025-09-09 14:50:32 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.37 sec.
2025-09-09 14:50:32 03094_one_thousand_joins: [ OK ] 11.89 sec.
2025-09-09 14:50:33 02095_function_get_os_kernel_version: [ OK ] 0.27 sec.
2025-09-09 14:50:33 02031_format_query_option: [ OK ] 0.62 sec.
2025-09-09 14:50:33 02366_kql_operator_in_sql: [ OK ] 0.47 sec.
2025-09-09 14:50:34 03001_backup_matview_after_modify_query: [ OK ] 3.13 sec.
2025-09-09 14:50:34 03131_deprecated_functions: [ OK ] 0.47 sec.
2025-09-09 14:50:34 00310_tskv: [ OK ] 1.87 sec.
2025-09-09 14:50:34 02513_prewhere_combine_step_filters: [ OK ] 0.47 sec.
2025-09-09 14:50:34 02955_analyzer_using_functional_args: [ OK ] 1.22 sec.
2025-09-09 14:50:34 02315_pmj_union_ubsan_35857: [ OK ] 0.28 sec.
2025-09-09 14:50:35 01012_select_limit_x_0: [ OK ] 0.37 sec.
2025-09-09 14:50:35 01525_select_with_offset_fetch_clause: [ OK ] 0.48 sec.
2025-09-09 14:50:35 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 3.53 sec.
2025-09-09 14:50:35 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.37 sec.
2025-09-09 14:50:36 01477_lc_in_merge_join_left_key: [ OK ] 0.77 sec.
2025-09-09 14:50:36 01548_create_table_compound_column_format: [ OK ] 0.72 sec.
2025-09-09 14:50:36 02592_avro_records_with_same_names: [ OK ] 0.77 sec.
2025-09-09 14:50:36 02971_functions_to_subcolumns_variant: [ OK ] 0.37 sec.
2025-09-09 14:50:36 02353_isnullable: [ OK ] 0.37 sec.
2025-09-09 14:50:36 03217_datetime64_constant_to_ast: [ OK ] 0.37 sec.
2025-09-09 14:50:36 00963_startsWith_force_primary_key: [ OK ] 0.37 sec.
2025-09-09 14:50:37 01084_defaults_on_aliases: [ OK ] 0.47 sec.
2025-09-09 14:50:37 01528_clickhouse_local_prepare_parts: [ OK ] 2.93 sec.
2025-09-09 14:50:37 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.47 sec.
2025-09-09 14:50:37 01308_row_policy_and_trivial_count_query: [ OK ] 0.37 sec.
2025-09-09 14:50:37 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2025-09-09 14:50:37 Reason: not running for current build
2025-09-09 14:50:37 01410_nullable_key_and_index_negate_cond: [ OK ] 0.47 sec.
2025-09-09 14:50:38 01940_custom_tld_sharding_key: [ OK ] 0.37 sec.
2025-09-09 14:50:38 01287_max_execution_speed: [ OK ] 4.38 sec.
2025-09-09 14:50:38 02313_cross_join_dup_col_names: [ OK ] 0.37 sec.
2025-09-09 14:50:38 01038_array_of_unnamed_tuples: [ OK ] 0.42 sec.
2025-09-09 14:50:39 03010_read_system_parts_table_test: [ OK ] 0.37 sec.
2025-09-09 14:50:39 01058_window_view_event_hop_to_strict_asc: [ OK ] 2.62 sec.
2025-09-09 14:50:39 02906_flatten_only_true_nested: [ OK ] 0.37 sec.
2025-09-09 14:50:39 02876_yyyymmddhhmmsstodatetime: [ OK ] 0.92 sec.
2025-09-09 14:50:39 01880_remote_ipv6: [ OK ] 0.47 sec.
2025-09-09 14:50:40 01113_local_dictionary_type_conversion: [ OK ] 0.37 sec.
2025-09-09 14:50:40 01272_totals_and_filter_bug: [ OK ] 0.47 sec.
2025-09-09 14:50:40 02122_parallel_formatting_JSONStrings: [ OK ] 3.33 sec.
2025-09-09 14:50:40 02840_grace_hash_join_structure_mismatch: [ OK ] 0.32 sec.
2025-09-09 14:50:40 02535_analyzer_limit_offset: [ OK ] 0.32 sec.
2025-09-09 14:50:40 02720_row_policy_column_with_dots: [ OK ] 0.37 sec.
2025-09-09 14:50:40 02845_arrayShiftRotate: [ OK ] 0.57 sec.
2025-09-09 14:50:41 01663_test_toDate_mysql_compatibility: [ OK ] 0.32 sec.
2025-09-09 14:50:41 02233_interpolate_1: [ OK ] 0.57 sec.
2025-09-09 14:50:41 02931_file_cluster: [ OK ] 0.87 sec.
2025-09-09 14:50:42 00029_test_zookeeper_optimize_exception: [ OK ] 4.63 sec.
2025-09-09 14:50:42 01937_nested_chinese: [ OK ] 0.42 sec.
2025-09-09 14:50:43 01540_verbatim_partition_pruning: [ OK ] 0.47 sec.
2025-09-09 14:50:43 01214_point_in_Mecca: [ OK ] 1.17 sec.
2025-09-09 14:50:43 02974_if_with_map: [ OK ] 0.37 sec.
2025-09-09 14:50:43 01300_wkt: [ OK ] 0.47 sec.
2025-09-09 14:50:45 01666_merge_tree_max_query_limit: [ OK ] 5.28 sec.
2025-09-09 14:50:45 02688_long_aggregate_function_names: [ OK ] 0.27 sec.
2025-09-09 14:50:45 02428_parameterized_view: [ OK ] 31.29 sec.
2025-09-09 14:50:46 00300_csv: [ OK ] 0.37 sec.
2025-09-09 14:50:48 01395_limit_more_cases: [ OK ] 19.77 sec.
2025-09-09 14:50:49 02024_compression_in_query: [ OK ] 3.43 sec.
2025-09-09 14:50:49 03274_format_inference_create_query_file: [ OK ] 1.17 sec.
2025-09-09 14:50:49 02732_rename_after_processing: [ OK ] 3.33 sec.
2025-09-09 14:50:49 02845_domain_rfc_support_ipv6: [ OK ] 0.37 sec.
2025-09-09 14:50:49 01470_columns_transformers: [ OK ] 0.57 sec.
2025-09-09 14:50:50 01825_type_json_nbagames: [ OK ] 6.33 sec.
2025-09-09 14:50:50 00988_parallel_parts_removal: [ OK ] 0.97 sec.
2025-09-09 14:50:51 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 1.62 sec.
2025-09-09 14:50:51 02784_disable_async_with_dedup_correctly: [ OK ] 7.79 sec.
2025-09-09 14:50:51 02678_explain_pipeline_graph_with_projection: [ OK ] 0.37 sec.
2025-09-09 14:50:51 02809_has_subsequence: [ OK ] 0.57 sec.
2025-09-09 14:50:51 00066_group_by_in: [ OK ] 0.32 sec.
2025-09-09 14:50:51 02992_analyzer_group_by_const: [ OK ] 0.52 sec.
2025-09-09 14:50:52 02456_alter-nullable-column-bag-2: [ OK ] 0.42 sec.
2025-09-09 14:50:52 03200_memory_engine_alter_dynamic: [ OK ] 0.37 sec.
2025-09-09 14:50:52 01670_log_comment: [ OK ] 0.62 sec.
2025-09-09 14:50:52 03167_empty_tuple_concat: [ OK ] 0.32 sec.
2025-09-09 14:50:52 01913_fix_column_transformer_replace_format: [ OK ] 0.32 sec.
2025-09-09 14:50:53 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.57 sec.
2025-09-09 14:50:53 02790_async_queries_in_query_log: [ OK ] 12.55 sec.
2025-09-09 14:50:53 01632_max_partitions_to_read: [ OK ] 0.37 sec.
2025-09-09 14:50:53 01670_distributed_bytes_to_throw_insert: [ OK ] 0.37 sec.
2025-09-09 14:50:54 00048_a_stored_aggregates_merge: [ OK ] 0.42 sec.
2025-09-09 14:50:54 03034_dynamic_conversions: [ OK ] 0.47 sec.
2025-09-09 14:50:54 00421_storage_merge__table_index: [ OK ] 13.70 sec.
2025-09-09 14:50:54 02932_parallel_replicas_fuzzer: [ OK ] 0.42 sec.
2025-09-09 14:50:54 02534_parquet_fixed_binary_array: [ OK ] 2.02 sec.
2025-09-09 14:50:54 02096_totals_global_in_bug: [ OK ] 0.37 sec.
2025-09-09 14:50:54 02871_join_on_system_errors: [ OK ] 0.32 sec.
2025-09-09 14:50:54 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.42 sec.
2025-09-09 14:50:54 01780_range_msan: [ OK ] 0.32 sec.
2025-09-09 14:50:55 01521_format_readable_time_delta2: [ OK ] 0.42 sec.
2025-09-09 14:50:55 02113_format_row: [ OK ] 0.37 sec.
2025-09-09 14:50:55 00059_shard_global_in_mergetree: [ OK ] 0.47 sec.
2025-09-09 14:50:55 02155_parse_date_lowcard_default_throw: [ OK ] 0.32 sec.
2025-09-09 14:50:55 02012_changed_enum_type_non_replicated: [ OK ] 0.37 sec.
2025-09-09 14:50:55 02833_std_alias: [ OK ] 0.37 sec.
2025-09-09 14:50:56 02525_analyzer_function_in_crash_fix: [ OK ] 0.32 sec.
2025-09-09 14:50:56 03034_ddls_and_merges_with_unusual_maps: [ OK ] 0.50 sec.
2025-09-09 14:50:56 02946_literal_alias_misclassification: [ OK ] 0.32 sec.
2025-09-09 14:50:56 00799_function_dry_run: [ OK ] 0.37 sec.
2025-09-09 14:50:56 02902_select_subcolumns_from_engine_null: [ OK ] 0.32 sec.
2025-09-09 14:50:56 02122_parallel_formatting_TSVWithNames: [ OK ] 1.97 sec.
2025-09-09 14:50:56 02500_analyzer_storage_view_crash_fix: [ OK ] 0.47 sec.
2025-09-09 14:50:57 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.37 sec.
2025-09-09 14:50:57 02789_jit_cannot_convert_column: [ OK ] 0.32 sec.
2025-09-09 14:50:57 02125_lz4_compression_bug_TSKV: [ OK ] 5.18 sec.
2025-09-09 14:50:57 00185_array_literals: [ OK ] 0.37 sec.
2025-09-09 14:50:57 02377_modify_column_from_lc: [ OK ] 0.52 sec.
2025-09-09 14:50:57 02165_h3_num_hexagons: [ OK ] 0.37 sec.
2025-09-09 14:50:57 02669_alter_modify_to_nullable: [ OK ] 0.52 sec.
2025-09-09 14:50:57 01710_normal_projection_format: [ OK ] 0.32 sec.
2025-09-09 14:50:57 01821_to_date_time_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:50:58 00129_quantile_timing_weighted: [ OK ] 0.32 sec.
2025-09-09 14:50:58 02456_async_inserts_logs: [ OK ] 8.59 sec.
2025-09-09 14:50:58 01442_h3kring_range_check: [ OK ] 0.42 sec.
2025-09-09 14:50:58 02475_analysis_of_variance: [ OK ] 0.42 sec.
2025-09-09 14:50:58 00612_pk_in_tuple_perf: [ OK ] 2.97 sec.
2025-09-09 14:50:58 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.32 sec.
2025-09-09 14:50:59 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.32 sec.
2025-09-09 14:50:59 02904_empty_order_by_with_setting_enabled: [ OK ] 1.42 sec.
2025-09-09 14:50:59 00251_has_types: [ OK ] 0.47 sec.
2025-09-09 14:50:59 02679_query_parameters_dangling_pointer: [ OK ] 0.32 sec.
2025-09-09 14:50:59 02933_sqid: [ OK ] 1.87 sec.
2025-09-09 14:50:59 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.42 sec.
2025-09-09 14:50:59 01049_window_view_window_functions: [ OK ] 0.57 sec.
2025-09-09 14:51:00 02967_analyzer_fuzz: [ OK ] 0.37 sec.
2025-09-09 14:51:00 00880_decimal_in_key: [ OK ] 1.17 sec.
2025-09-09 14:51:00 02498_random_string_in_json_schema_inference: [ OK ] 0.77 sec.
2025-09-09 14:51:00 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.42 sec.
2025-09-09 14:51:00 01081_window_view_target_table_engine: [ OK ] 2.07 sec.
2025-09-09 14:51:01 02901_analyzer_recursive_window: [ OK ] 0.32 sec.
2025-09-09 14:51:01 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.37 sec.
2025-09-09 14:51:01 00601_kill_running_query: [ OK ] 0.62 sec.
2025-09-09 14:51:01 01268_mergine_sorted_limit: [ OK ] 0.32 sec.
2025-09-09 14:51:01 01890_jit_aggregation_function_sum_long: [ OK ] 0.88 sec.
2025-09-09 14:51:01 02783_parsedatetimebesteffort_syslog: [ OK ] 0.37 sec.
2025-09-09 14:51:01 01710_order_by_projections_incomplete: [ OK ] 0.37 sec.
2025-09-09 14:51:01 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.47 sec.
2025-09-09 14:51:02 00409_shard_limit_by: [ OK ] 0.47 sec.
2025-09-09 14:51:02 02004_intersect_except_distinct_operators: [ OK ] 0.87 sec.
2025-09-09 14:51:02 01417_update_permutation_crash: [ OK ] 0.52 sec.
2025-09-09 14:51:02 02167_format_from_file_extension: [ OK ] 12.95 sec.
2025-09-09 14:51:02 00008_array_join: [ OK ] 0.42 sec.
2025-09-09 14:51:02 00697_in_subquery_shard: [ OK ] 0.52 sec.
2025-09-09 14:51:03 00559_filter_array_generic: [ OK ] 0.32 sec.
2025-09-09 14:51:03 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 0.77 sec.
2025-09-09 14:51:04 00400_client_external_options: [ OK ] 2.02 sec.
2025-09-09 14:51:04 00340_squashing_insert_select: [ OK ] 1.37 sec.
2025-09-09 14:51:05 03199_unbin_buffer_overflow: [ OK ] 7.53 sec.
2025-09-09 14:51:05 02897_alter_partition_parameters: [ OK ] 0.62 sec.
2025-09-09 14:51:05 03213_rand_dos: [ OK ] 0.37 sec.
2025-09-09 14:51:06 00910_buffer_prewhere: [ OK ] 0.32 sec.
2025-09-09 14:51:06 00900_orc_arrow_parquet_tuples: [ OK ] 5.08 sec.
2025-09-09 14:51:06 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.47 sec.
2025-09-09 14:51:06 03038_nested_dynamic_merges_compact_horizontal: [ OK ] 3.43 sec.
2025-09-09 14:51:06 02577_analyzer_array_join_calc_twice: [ OK ] 0.32 sec.
2025-09-09 14:51:07 02135_local_create_db: [ OK ] 0.92 sec.
2025-09-09 14:51:07 02681_aggregation_by_partitions_bug: [ OK ] 0.37 sec.
2025-09-09 14:51:07 03230_subcolumns_mv: [ OK ] 0.37 sec.
2025-09-09 14:51:07 01683_intdiv_ubsan: [ OK ] 0.42 sec.
2025-09-09 14:51:07 01691_parser_data_type_exponential: [ OK ] 3.13 sec.
2025-09-09 14:51:07 01553_datetime64_comparison: [ OK ] 0.32 sec.
2025-09-09 14:51:07 02815_range_dict_no_direct_join: [ OK ] 0.37 sec.
2025-09-09 14:51:07 01441_array_combinator: [ OK ] 0.32 sec.
2025-09-09 14:51:08 01433_hex_float: [ OK ] 0.32 sec.
2025-09-09 14:51:08 01580_column_const_comparision: [ OK ] 0.32 sec.
2025-09-09 14:51:08 02771_jit_functions_comparison_crash: [ OK ] 0.37 sec.
2025-09-09 14:51:08 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.32 sec.
2025-09-09 14:51:08 00404_null_literal: [ OK ] 0.37 sec.
2025-09-09 14:51:08 02407_array_element_from_map_wrong_type: [ OK ] 0.27 sec.
2025-09-09 14:51:08 02454_set_parameters_formatting: [ OK ] 0.72 sec.
2025-09-09 14:51:09 01825_new_type_json_11: [ OK ] 3.78 sec.
2025-09-09 14:51:09 01550_create_map_type: [ OK ] 0.82 sec.
2025-09-09 14:51:09 01710_minmax_count_projection_constant_query: [ OK ] 0.37 sec.
2025-09-09 14:51:09 02477_s3_request_throttler: [ OK ] 2.22 sec.
2025-09-09 14:51:09 01496_signedness_conversion_monotonicity: [ OK ] 0.32 sec.
2025-09-09 14:51:09 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.37 sec.
2025-09-09 14:51:09 02899_distributed_limit_by: [ OK ] 0.67 sec.
2025-09-09 14:51:09 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.37 sec.
2025-09-09 14:51:10 02833_sparse_columns_tuple_function: [ OK ] 0.32 sec.
2025-09-09 14:51:10 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 7.09 sec.
2025-09-09 14:51:10 01293_external_sorting_limit_bug: [ OK ] 0.42 sec.
2025-09-09 14:51:10 00080_show_tables_and_system_tables: [ OK ] 0.37 sec.
2025-09-09 14:51:10 00737_decimal_group_by: [ OK ] 0.37 sec.
2025-09-09 14:51:10 02525_different_engines_in_temporary_tables: [ OK ] 0.47 sec.
2025-09-09 14:51:11 02097_remove_sample_by: [ OK ] 0.47 sec.
2025-09-09 14:51:11 01763_long_ttl_group_by: [ OK ] 1.47 sec.
2025-09-09 14:51:11 00967_insert_into_distributed_different_types: [ OK ] 0.42 sec.
2025-09-09 14:51:11 01307_orc_output_format: [ OK ] 2.82 sec.
2025-09-09 14:51:11 03036_schema_inference_cache_s3_archives: [ OK ] 0.42 sec.
2025-09-09 14:51:11 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.42 sec.
2025-09-09 14:51:12 01913_names_of_tuple_literal: [ OK ] 0.47 sec.
2025-09-09 14:51:12 00980_crash_nullable_decimal: [ OK ] 0.38 sec.
2025-09-09 14:51:12 02962_join_using_bug_57894: [ OK ] 0.37 sec.
2025-09-09 14:51:12 02497_having_without_actual_aggregation_bug: [ OK ] 0.37 sec.
2025-09-09 14:51:12 00980_full_join_crash_fancyqlx: [ OK ] 0.37 sec.
2025-09-09 14:51:12 01812_has_generic: [ OK ] 0.32 sec.
2025-09-09 14:51:12 01561_aggregate_functions_of_key_with_join: [ OK ] 0.32 sec.
2025-09-09 14:51:13 01770_add_months_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:51:13 01932_global_in_function: [ OK ] 0.37 sec.
2025-09-09 14:51:13 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.37 sec.
2025-09-09 14:51:13 01513_optimize_aggregation_in_order_memory_long: [ OK ] 3.48 sec.
2025-09-09 14:51:13 01460_mark_inclusion_search_crash: [ OK ] 0.37 sec.
2025-09-09 14:51:13 02992_all_columns_should_have_comment: [ OK ] 0.57 sec.
2025-09-09 14:51:13 03093_special_column_errors: [ OK ] 0.57 sec.
2025-09-09 14:51:14 01355_alter_column_with_order: [ OK ] 0.42 sec.
2025-09-09 14:51:14 01356_state_resample: [ OK ] 0.37 sec.
2025-09-09 14:51:14 00849_multiple_comma_join_2: [ OK ] 0.92 sec.
2025-09-09 14:51:14 01927_query_views_log_matview_exceptions: [ OK ] 4.98 sec.
2025-09-09 14:51:15 00041_big_array_join: [ OK ] 0.47 sec.
2025-09-09 14:51:15 02891_functions_over_sparse_columns: [ OK ] 0.37 sec.
2025-09-09 14:51:15 01550_query_identifier_parameters: [ OK ] 2.09 sec.
2025-09-09 14:51:15 01017_tuplehamming_distance: [ OK ] 0.37 sec.
2025-09-09 14:51:15 02515_analyzer_null_for_empty: [ OK ] 0.37 sec.
2025-09-09 14:51:15 02538_alter_rename_sequence: [ OK ] 0.57 sec.
2025-09-09 14:51:16 02377_analyzer_in_function_set: [ OK ] 0.42 sec.
2025-09-09 14:51:16 00098_l_union_all: [ OK ] 0.37 sec.
2025-09-09 14:51:16 02233_with_total_empty_chunk: [ OK ] 0.32 sec.
2025-09-09 14:51:17 02373_datetime64_monotonicity: [ OK ] 2.62 sec.
2025-09-09 14:51:17 02047_log_family_complex_structs_data_file_dumps: [ OK ] 6.94 sec.
2025-09-09 14:51:18 02520_group_array_last: [ OK ] 0.62 sec.
2025-09-09 14:51:18 02859_replicated_db_name_zookeeper: [ OK ] 2.38 sec.
2025-09-09 14:51:18 00517_date_parsing: [ OK ] 0.47 sec.
2025-09-09 14:51:19 00825_protobuf_format_array_3dim: [ OK ] 1.92 sec.
2025-09-09 14:51:19 01538_fuzz_aggregate: [ OK ] 0.32 sec.
2025-09-09 14:51:19 01386_negative_float_constant_key_condition: [ OK ] 0.37 sec.
2025-09-09 14:51:19 01544_errorCodeToName: [ OK ] 0.32 sec.
2025-09-09 14:51:20 02466_distributed_query_profiler: [ OK ] 1.12 sec.
2025-09-09 14:51:20 01825_type_json_in_other_types: [ OK ] 3.68 sec.
2025-09-09 14:51:20 01183_custom_separated_format_http: [ OK ] 2.42 sec.
2025-09-09 14:51:20 02242_case_insensitive_column_matching: [ OK ] 4.68 sec.
2025-09-09 14:51:20 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.42 sec.
2025-09-09 14:51:20 01700_mod_negative_type_promotion: [ OK ] 0.37 sec.
2025-09-09 14:51:21 02177_sum_if_not_found: [ OK ] 0.37 sec.
2025-09-09 14:51:21 01801_s3_cluster_count: [ OK ] 0.42 sec.
2025-09-09 14:51:21 00085_visible_width_of_tuple_of_dates: [ OK ] 0.32 sec.
2025-09-09 14:51:21 02991_count_rewrite_analyzer: [ OK ] 0.37 sec.
2025-09-09 14:51:21 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.37 sec.
2025-09-09 14:51:21 02597_column_delete_and_replication: [ OK ] 1.37 sec.
2025-09-09 14:51:22 01406_carriage_return_in_tsv_csv: [ OK ] 1.57 sec.
2025-09-09 14:51:22 02476_fuse_sum_count: [ OK ] 0.62 sec.
2025-09-09 14:51:22 01387_clear_column_default_depends: [ OK ] 0.52 sec.
2025-09-09 14:51:22 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.57 sec.
2025-09-09 14:51:22 01290_max_execution_speed_distributed: [ OK ] 2.72 sec.
2025-09-09 14:51:22 00696_system_columns_limit: [ OK ] 0.37 sec.
2025-09-09 14:51:22 01276_system_licenses: [ OK ] 0.32 sec.
2025-09-09 14:51:22 03240_insert_select_named_tuple: [ OK ] 0.42 sec.
2025-09-09 14:51:22 00293_shard_max_subquery_depth: [ OK ] 0.42 sec.
2025-09-09 14:51:23 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.37 sec.
2025-09-09 14:51:23 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.37 sec.
2025-09-09 14:51:23 00298_enum_width_and_cast: [ OK ] 0.37 sec.
2025-09-09 14:51:23 03156_analyzer_array_join_distributed: [ OK ] 0.42 sec.
2025-09-09 14:51:23 00969_roundDuration: [ OK ] 0.37 sec.
2025-09-09 14:51:24 00183_skip_unavailable_shards: [ OK ] 24.33 sec.
2025-09-09 14:51:24 00688_aggregation_retention: [ OK ] 0.47 sec.
2025-09-09 14:51:24 02482_value_block_parsing: [ OK ] 0.97 sec.
2025-09-09 14:51:24 02343_aggregation_pipeline: [ OK ] 0.52 sec.
2025-09-09 14:51:24 02021_h3_is_res_classIII: [ OK ] 0.67 sec.
2025-09-09 14:51:24 02481_async_insert_dedup_token: [ OK ] 93.30 sec.
2025-09-09 14:51:24 02096_bad_options_in_client_and_local: [ OK ] 1.57 sec.
2025-09-09 14:51:25 02507_to_unix_timestamp_overflow: [ OK ] 0.32 sec.
2025-09-09 14:51:25 02016_agg_empty_result_bug_28880: [ OK ] 0.37 sec.
2025-09-09 14:51:25 00477_parsing_data_types: [ OK ] 0.27 sec.
2025-09-09 14:51:25 00999_join_on_expression: [ OK ] 0.52 sec.
2025-09-09 14:51:25 01681_hyperscan_debug_assertion: [ SKIPPED ] 0.00 sec.
2025-09-09 14:51:25 Reason: not running for current build
2025-09-09 14:51:25 03165_string_functions_with_token_text_indexes: [ OK ] 0.82 sec.
2025-09-09 14:51:25 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.47 sec.
2025-09-09 14:51:25 01041_h3_is_valid: [ OK ] 0.42 sec.
2025-09-09 14:51:25 02518_parquet_arrow_orc_boolean_value: [ OK ] 1.12 sec.
2025-09-09 14:51:25 00098_k_union_all: [ OK ] 0.37 sec.
2025-09-09 14:51:25 01053_if_chain_check: [ OK ] 0.37 sec.
2025-09-09 14:51:25 02177_issue_31009: [ SKIPPED ] 0.00 sec.
2025-09-09 14:51:25 Reason: not running for current build
2025-09-09 14:51:26 01654_test_writer_block_sequence: [ OK ] 12.60 sec.
2025-09-09 14:51:26 03208_array_of_json_read_subcolumns_1: [ OK ] 4.13 sec.
2025-09-09 14:51:26 01032_duplicate_column_insert_query: [ OK ] 0.37 sec.
2025-09-09 14:51:26 02383_arrow_dict_special_cases: [ OK ] 3.53 sec.
2025-09-09 14:51:26 02711_trim_aliases: [ OK ] 0.32 sec.
2025-09-09 14:51:26 02030_client_unknown_database: [ OK ] 0.87 sec.
2025-09-09 14:51:26 01818_case_float_value_fangyc: [ OK ] 0.32 sec.
2025-09-09 14:51:26 00800_versatile_storage_join: [ OK ] 0.47 sec.
2025-09-09 14:51:26 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.47 sec.
2025-09-09 14:51:26 00952_part_frozen_info: [ OK ] 0.37 sec.
2025-09-09 14:51:26 01519_topK_distributed_parametrized: [ OK ] 0.37 sec.
2025-09-09 14:51:27 00181_aggregate_functions_statistics_stable: [ OK ] 0.57 sec.
2025-09-09 14:51:27 02223_h3_test_const_columns: [ OK ] 0.52 sec.
2025-09-09 14:51:27 02176_optimize_aggregation_in_order_empty: [ OK ] 0.37 sec.
2025-09-09 14:51:27 01483_merge_table_join_and_group_by: [ OK ] 0.52 sec.
2025-09-09 14:51:27 01480_binary_operator_monotonicity: [ OK ] 0.62 sec.
2025-09-09 14:51:27 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 1.47 sec.
2025-09-09 14:51:27 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.37 sec.
2025-09-09 14:51:27 00356_analyze_aggregations_and_union_all: [ OK ] 0.32 sec.
2025-09-09 14:51:27 01550_mutation_subquery: [ OK ] 0.37 sec.
2025-09-09 14:51:27 01060_window_view_event_tumble_to_asc: [ OK ] 2.37 sec.
2025-09-09 14:51:27 02718_cli_dashed_options_parsing: [ OK ] 2.02 sec.
2025-09-09 14:51:27 01508_explain_header: [ OK ] 0.32 sec.
2025-09-09 14:51:28 00088_distinct_of_arrays_of_strings: [ OK ] 0.32 sec.
2025-09-09 14:51:28 02766_bitshift_with_const_arguments: [ OK ] 0.47 sec.
2025-09-09 14:51:28 02943_variant_element: [ OK ] 0.37 sec.
2025-09-09 14:51:28 02684_bson: [ OK ] 0.32 sec.
2025-09-09 14:51:28 02752_space_function: [ OK ] 0.52 sec.
2025-09-09 14:51:28 01440_big_int_shift: [ OK ] 0.32 sec.
2025-09-09 14:51:28 00387_use_client_time_zone: [ OK ] 0.82 sec.
2025-09-09 14:51:28 02813_seriesDecomposeSTL: [ OK ] 0.47 sec.
2025-09-09 14:51:28 03203_fill_missed_subcolumns: [ OK ] 0.47 sec.
2025-09-09 14:51:29 02009_array_join_partition: [ OK ] 0.32 sec.
2025-09-09 14:51:29 01202_array_auc_special: [ OK ] 0.42 sec.
2025-09-09 14:51:29 01631_date_overflow_as_partition_key: [ OK ] 0.37 sec.
2025-09-09 14:51:29 02734_optimize_group_by: [ OK ] 0.37 sec.
2025-09-09 14:51:29 03032_storage_memory_modify_settings: [ OK ] 0.62 sec.
2025-09-09 14:51:30 02969_archive_seek: [ OK ] 0.82 sec.
2025-09-09 14:51:30 00632_aggregation_window_funnel: [ OK ] 0.92 sec.
2025-09-09 14:51:30 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 1.22 sec.
2025-09-09 14:51:30 01018_ambiguous_column: [ OK ] 0.42 sec.
2025-09-09 14:51:30 03215_view_with_recursive: [ OK ] 0.52 sec.
2025-09-09 14:51:30 03096_largest_triangle_3b_crash: [ OK ] 0.32 sec.
2025-09-09 14:51:31 02267_empty_arrays_read_reverse: [ OK ] 0.67 sec.
2025-09-09 14:51:31 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 3.28 sec.
2025-09-09 14:51:31 00999_join_not_nullable_types: [ OK ] 0.32 sec.
2025-09-09 14:51:31 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.37 sec.
2025-09-09 14:51:32 02266_protobuf_format_google_wrappers: [ OK ] 4.68 sec.
2025-09-09 14:51:32 00612_http_max_query_size_for_distributed: [ OK ] 0.37 sec.
2025-09-09 14:51:32 00934_is_valid_utf8: [ OK ] 0.92 sec.
2025-09-09 14:51:32 02020_cast_integer_overflow: [ OK ] 0.42 sec.
2025-09-09 14:51:32 00947_ml_test: [ OK ] 0.42 sec.
2025-09-09 14:51:33 02560_tuple_format: [ OK ] 0.72 sec.
2025-09-09 14:51:33 02841_not_ready_set_constraints: [ OK ] 0.42 sec.
2025-09-09 14:51:33 02723_jit_aggregation_bug_48120: [ OK ] 0.42 sec.
2025-09-09 14:51:33 01825_new_type_json_bools: [ OK ] 0.32 sec.
2025-09-09 14:51:33 03271_decimal_monotonic_day_of_week: [ OK ] 0.37 sec.
2025-09-09 14:51:33 03032_scalars_create_as_select: [ OK ] 0.32 sec.
2025-09-09 14:51:33 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.47 sec.
2025-09-09 14:51:33 02885_create_distributed_table_without_as: [ OK ] 0.37 sec.
2025-09-09 14:51:33 03038_nested_dynamic_merges_compact_vertical: [ OK ] 2.98 sec.
2025-09-09 14:51:34 02436_system_zookeeper_context: [ OK ] 0.37 sec.
2025-09-09 14:51:34 01549_low_cardinality_mv_fuzz: [ OK ] 0.32 sec.
2025-09-09 14:51:34 02834_array_exists_segfault: [ OK ] 0.32 sec.
2025-09-09 14:51:34 00978_ml_math: [ OK ] 0.32 sec.
2025-09-09 14:51:34 02990_arrayFold_nullable_lc: [ OK ] 0.47 sec.
2025-09-09 14:51:34 02015_async_inserts_4: [ OK ] 5.03 sec.
2025-09-09 14:51:34 02180_group_by_lowcardinality: [ OK ] 0.22 sec.
2025-09-09 14:51:34 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.42 sec.
2025-09-09 14:51:34 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.32 sec.
2025-09-09 14:51:34 02267_join_dup_columns_issue36199: [ OK ] 0.47 sec.
2025-09-09 14:51:34 00679_replace_asterisk: [ OK ] 0.37 sec.
2025-09-09 14:51:34 01710_projection_in_set: [ OK ] 0.42 sec.
2025-09-09 14:51:35 02874_analysis_of_variance_overflow: [ OK ] 0.37 sec.
2025-09-09 14:51:35 02149_issue_32487: [ OK ] 0.32 sec.
2025-09-09 14:51:35 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.37 sec.
2025-09-09 14:51:35 00621_regression_for_in_operator: [ OK ] 0.47 sec.
2025-09-09 14:51:35 02183_combinator_if: [ OK ] 0.92 sec.
2025-09-09 14:51:36 02017_columns_with_dot_2: [ OK ] 0.32 sec.
2025-09-09 14:51:36 01511_different_expression_with_same_alias: [ OK ] 0.47 sec.
2025-09-09 14:51:36 02875_parallel_replicas_remote: [ OK ] 1.02 sec.
2025-09-09 14:51:36 02811_parallel_replicas_prewhere_count: [ OK ] 0.37 sec.
2025-09-09 14:51:36 00650_csv_with_specified_quote_rule: [ OK ] 5.68 sec.
2025-09-09 14:51:36 01458_is_decimal_overflow: [ OK ] 0.52 sec.
2025-09-09 14:51:37 02661_read_from_archive_zip: [ OK ] 10.79 sec.
2025-09-09 14:51:37 02013_zlib_read_after_eof: [ OK ] 2.42 sec.
2025-09-09 14:51:37 00804_test_custom_compression_codes_log_storages: [ OK ] 0.67 sec.
2025-09-09 14:51:37 02812_subquery_operators: [ OK ] 0.37 sec.
2025-09-09 14:51:37 01088_array_slice_of_aggregate_functions: [ OK ] 0.32 sec.
2025-09-09 14:51:37 02538_analyzer_create_table_as_select: [ OK ] 0.37 sec.
2025-09-09 14:51:37 02493_inconsistent_hex_and_binary_number: [ OK ] 2.42 sec.
2025-09-09 14:51:37 03215_varian_as_common_type_tuple_map: [ OK ] 0.32 sec.
2025-09-09 14:51:37 02151_http_s_structure_set_eof: [ OK ] 1.47 sec.
2025-09-09 14:51:37 00950_default_prewhere: [ OK ] 0.47 sec.
2025-09-09 14:51:37 02486_truncate_and_unexpected_parts: [ OK ] 1.42 sec.
2025-09-09 14:51:37 01470_columns_transformers2: [ OK ] 0.37 sec.
2025-09-09 14:51:38 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.37 sec.
2025-09-09 14:51:38 02869_http_headers_elapsed_ns: [ OK ] 0.67 sec.
2025-09-09 14:51:38 02806_cte_block_cannot_be_empty: [ OK ] 0.37 sec.
2025-09-09 14:51:38 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.42 sec.
2025-09-09 14:51:38 03269_partition_key_not_in_set: [ OK ] 0.67 sec.
2025-09-09 14:51:38 01043_categorical_iv: [ OK ] 0.47 sec.
2025-09-09 14:51:38 01518_select_in_null: [ OK ] 1.07 sec.
2025-09-09 14:51:38 00552_logical_functions_simple: [ OK ] 0.37 sec.
2025-09-09 14:51:39 01616_untuple_access_field: [ OK ] 0.32 sec.
2025-09-09 14:51:39 02421_json_decimals_as_strings: [ OK ] 0.32 sec.
2025-09-09 14:51:39 01107_tuples_arrays_parsing_exceptions: [ OK ] 1.07 sec.
2025-09-09 14:51:39 00667_compare_arrays_of_different_types: [ OK ] 0.43 sec.
2025-09-09 14:51:39 02809_has_token: [ OK ] 0.42 sec.
2025-09-09 14:51:39 01198_client_quota_key: [ OK ] 1.27 sec.
2025-09-09 14:51:39 01069_insert_float_as_nullable_unit8: [ OK ] 0.37 sec.
2025-09-09 14:51:39 01428_hash_set_nan_key: [ OK ] 0.37 sec.
2025-09-09 14:51:40 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 1.42 sec.
2025-09-09 14:51:40 02918_template_format_deadlock: [ OK ] 0.87 sec.
2025-09-09 14:51:40 02187_test_final_and_limit_modifier: [ OK ] 0.38 sec.
2025-09-09 14:51:40 02456_bloom_filter_assert: [ OK ] 0.72 sec.
2025-09-09 14:51:41 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.82 sec.
2025-09-09 14:51:41 02337_join_analyze_stuck: [ OK ] 0.92 sec.
2025-09-09 14:51:41 01104_fixed_string_like: [ OK ] 0.72 sec.
2025-09-09 14:51:41 02479_mysql_connect_to_self: [ OK ] 1.32 sec.
2025-09-09 14:51:41 03002_map_array_functions_with_low_cardinality: [ OK ] 0.32 sec.
2025-09-09 14:51:41 00674_has_array_enum: [ OK ] 0.32 sec.
2025-09-09 14:51:41 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.62 sec.
2025-09-09 14:51:41 01719_join_timezone: [ OK ] 0.42 sec.
2025-09-09 14:51:42 02725_any_join_single_row: [ OK ] 0.62 sec.
2025-09-09 14:51:42 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.47 sec.
2025-09-09 14:51:42 00955_complex_prepared_statements: [ OK ] 3.98 sec.
2025-09-09 14:51:42 02366_window_function_order_by: [ OK ] 0.32 sec.
2025-09-09 14:51:42 03127_argMin_combinator_state: [ OK ] 0.42 sec.
2025-09-09 14:51:42 03093_filter_push_down_crash: [ OK ] 0.37 sec.
2025-09-09 14:51:42 02668_parse_datetime_in_joda_syntax: [ OK ] 0.97 sec.
2025-09-09 14:51:42 00905_compile_expressions_compare_big_dates: [ OK ] 0.37 sec.
2025-09-09 14:51:43 00440_nulls_merge_tree: [ OK ] 0.32 sec.
2025-09-09 14:51:43 02675_grant_query_formatting: [ OK ] 0.57 sec.
2025-09-09 14:51:43 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec.
2025-09-09 14:51:43 Reason: not running for current build
2025-09-09 14:51:43 00191_aggregating_merge_tree_and_final: [ OK ] 0.42 sec.
2025-09-09 14:51:43 00623_truncate_table: [ OK ] 0.82 sec.
2025-09-09 14:51:43 00065_shard_float_literals_formatting: [ OK ] 0.42 sec.
2025-09-09 14:51:43 00554_nested_and_table_engines: [ OK ] 0.72 sec.
2025-09-09 14:51:44 00553_buff_exists_materlized_column: [ OK ] 0.38 sec.
2025-09-09 14:51:44 02915_input_table_function_in_subquery: [ OK ] 1.13 sec.
2025-09-09 14:51:44 00159_whitespace_in_columns_list: [ OK ] 0.37 sec.
2025-09-09 14:51:44 02565_update_empty_nested: [ OK ] 0.57 sec.
2025-09-09 14:51:44 00434_tonullable: [ OK ] 0.32 sec.
2025-09-09 14:51:44 00231_format_vertical_raw: [ OK ] 0.32 sec.
2025-09-09 14:51:45 01755_shard_pruning_with_literal: [ OK ] 0.38 sec.
2025-09-09 14:51:45 02771_if_constant_folding: [ OK ] 0.32 sec.
2025-09-09 14:51:45 02245_make_datetime64: [ OK ] 0.87 sec.
2025-09-09 14:51:45 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.37 sec.
2025-09-09 14:51:45 00538_datediff: [ OK ] 0.67 sec.
2025-09-09 14:51:45 01014_count_of_merges_metrics: [ OK ] 0.52 sec.
2025-09-09 14:51:46 02165_h3_edge_length_km: [ OK ] 0.37 sec.
2025-09-09 14:51:46 01954_clickhouse_benchmark_multiple_long: [ OK ] 9.05 sec.
2025-09-09 14:51:46 02122_parallel_formatting_TSV: [ OK ] 2.32 sec.
2025-09-09 14:51:46 01853_s2_cells_intersect: [ OK ] 0.37 sec.
2025-09-09 14:51:46 00426_nulls_sorting: [ OK ] 0.42 sec.
2025-09-09 14:51:47 02915_analyzer_fuzz_6: [ OK ] 0.43 sec.
2025-09-09 14:51:47 00165_transform_non_const_default: [ OK ] 0.42 sec.
2025-09-09 14:51:47 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 0.82 sec.
2025-09-09 14:51:47 03142_window_function_limit_by: [ OK ] 0.52 sec.
2025-09-09 14:51:47 01739_index_hint: [ OK ] 0.67 sec.
2025-09-09 14:51:48 00045_sorting_by_fixed_string_descending: [ OK ] 0.32 sec.
2025-09-09 14:51:48 00328_long_case_construction: [ OK ] 20.43 sec.
2025-09-09 14:51:48 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.32 sec.
2025-09-09 14:51:48 01880_materialized_view_to_table_type_check: [ OK ] 0.52 sec.
2025-09-09 14:51:48 03273_dictionary_rbac: [ OK ] 2.77 sec.
2025-09-09 14:51:48 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.37 sec.
2025-09-09 14:51:48 02869_unicode_minus: [ OK ] 0.32 sec.
2025-09-09 14:51:48 00535_parse_float_scientific: [ OK ] 0.37 sec.
2025-09-09 14:51:49 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.32 sec.
2025-09-09 14:51:49 00322_disable_checksumming: [ OK ] 0.57 sec.
2025-09-09 14:51:49 01013_totals_without_aggregation: [ OK ] 0.32 sec.
2025-09-09 14:51:49 02342_window_view_different_struct: [ OK ] 0.52 sec.
2025-09-09 14:51:49 02566_analyzer_limit_settings_distributed: [ OK ] 0.37 sec.
2025-09-09 14:51:49 02674_trivial_count_analyzer: [ OK ] 0.52 sec.
2025-09-09 14:51:49 01585_use_index_for_global_in: [ OK ] 0.37 sec.
2025-09-09 14:51:50 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.42 sec.
2025-09-09 14:51:51 00111_shard_external_sort_distributed: [ OK ] 4.48 sec.
2025-09-09 14:51:51 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 2.23 sec.
2025-09-09 14:51:51 01522_validate_alter_default: [ OK ] 0.32 sec.
2025-09-09 14:51:51 03169_time_virtual_column: [ OK ] 1.67 sec.
2025-09-09 14:51:52 00856_no_column_issue_4242: [ OK ] 0.42 sec.
2025-09-09 14:51:52 00653_monotonic_integer_cast: [ OK ] 0.32 sec.
2025-09-09 14:51:52 01923_different_expression_name_alias: [ OK ] 0.42 sec.
2025-09-09 14:51:52 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.37 sec.
2025-09-09 14:51:52 03002_int_div_decimal_with_date_bug: [ OK ] 0.32 sec.
2025-09-09 14:51:52 01018_ddl_dictionaries_special: [ OK ] 0.52 sec.
2025-09-09 14:51:52 02933_replicated_database_forbid_create_as_select: [ OK ] 3.78 sec.
2025-09-09 14:51:53 02470_suspicious_low_cardinality_msan: [ OK ] 0.37 sec.
2025-09-09 14:51:53 00061_merge_tree_alter: [ OK ] 0.57 sec.
2025-09-09 14:51:53 03205_json_cast_from_string: [ OK ] 0.42 sec.
2025-09-09 14:51:53 03049_unknown_identifier_materialized_column: [ OK ] 0.37 sec.
2025-09-09 14:51:53 01398_in_tuple_func: [ OK ] 0.57 sec.
2025-09-09 14:51:54 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.37 sec.
2025-09-09 14:51:54 02998_http_redirects: [ OK ] 0.57 sec.
2025-09-09 14:51:55 02124_insert_deduplication_token_materialized_views: [ OK ] 1.97 sec.
2025-09-09 14:51:55 02843_context_has_expired: [ OK ] 0.42 sec.
2025-09-09 14:51:56 02956_rocksdb_with_ttl: [ OK ] 3.43 sec.
2025-09-09 14:51:56 02015_async_inserts_7: [ OK ] 6.93 sec.
2025-09-09 14:51:56 02131_materialize_column_cast: [ OK ] 0.47 sec.
2025-09-09 14:51:56 00929_multi_match_edit_distance: [ OK ] 1.62 sec.
2025-09-09 14:51:57 02029_test_implemented_methods: [ OK ] 0.57 sec.
2025-09-09 14:51:57 01376_array_fill_empty: [ OK ] 0.32 sec.
2025-09-09 14:51:57 00933_alter_ttl: [ OK ] 0.42 sec.
2025-09-09 14:51:57 03145_unicode_quotes: [ OK ] 0.32 sec.
2025-09-09 14:51:57 00392_enum_nested_alter: [ OK ] 0.62 sec.
2025-09-09 14:51:57 01825_type_json_field: [ OK ] 0.47 sec.
2025-09-09 14:51:57 01682_gather_utils_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:51:57 01071_window_view_event_tumble_asc_join: [ OK ] 2.82 sec.
2025-09-09 14:51:58 02784_schema_inference_null_as_default: [ OK ] 0.37 sec.
2025-09-09 14:51:58 02920_alter_column_of_projections: [ OK ] 0.42 sec.
2025-09-09 14:51:58 00149_function_url_hash: [ OK ] 0.37 sec.
2025-09-09 14:51:58 02844_table_function_url_filter_by_virtual_columns: [ OK ] 0.82 sec.
2025-09-09 14:51:58 00520_tuple_values_interpreter: [ OK ] 0.42 sec.
2025-09-09 14:51:59 02503_join_switch_alias_fuzz: [ OK ] 0.32 sec.
2025-09-09 14:52:00 01273_arrow_dictionaries_load: [ OK ] 6.33 sec.
2025-09-09 14:52:00 00900_orc_arrays_load: [ OK ] 2.63 sec.
2025-09-09 14:52:00 01927_query_views_log_current_database: [ OK ] 0.97 sec.
2025-09-09 14:52:00 01921_with_fill_with_totals: [ OK ] 0.32 sec.
2025-09-09 14:52:00 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.42 sec.
2025-09-09 14:52:00 03095_msan_uuid_string_to_num: [ OK ] 0.32 sec.
2025-09-09 14:52:00 02122_parallel_formatting_JSON: [ OK ] 2.83 sec.
2025-09-09 14:52:01 03023_invalid_format_detection: [ OK ] 0.87 sec.
2025-09-09 14:52:01 02041_test_fuzzy_alter: [ OK ] 0.42 sec.
2025-09-09 14:52:01 02179_bool_type: [ OK ] 0.47 sec.
2025-09-09 14:52:02 01176_mysql_client_interactive: [ OK ] 1.42 sec.
2025-09-09 14:52:02 01279_empty_external_table: [ OK ] 1.57 sec.
2025-09-09 14:52:02 02478_analyzer_table_expression_aliases: [ OK ] 0.47 sec.
2025-09-09 14:52:03 02346_fulltext_index_search: [ OK ] 2.07 sec.
2025-09-09 14:52:03 01135_default_and_alter_zookeeper: [ OK ] 0.37 sec.
2025-09-09 14:52:03 02973_parse_crlf_with_tsv_files: [ OK ] 1.62 sec.
2025-09-09 14:52:03 02243_ipv6_long_parsing: [ OK ] 0.37 sec.
2025-09-09 14:52:03 00122_join_with_subquery_with_subquery: [ OK ] 0.32 sec.
2025-09-09 14:52:03 01377_supertype_low_cardinality: [ OK ] 0.52 sec.
2025-09-09 14:52:03 01661_week_functions_string_args: [ OK ] 0.57 sec.
2025-09-09 14:52:04 02125_lz4_compression_bug_Values: [ OK ] 5.73 sec.
2025-09-09 14:52:04 01921_datatype_date32: [ OK ] 0.82 sec.
2025-09-09 14:52:04 03054_analyzer_join_alias: [ OK ] 0.32 sec.
2025-09-09 14:52:04 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.32 sec.
2025-09-09 14:52:04 03262_column_sizes_with_dynamic_structure: [ OK ] 1.52 sec.
2025-09-09 14:52:05 01421_array_nullable_element_nullable_index: [ OK ] 0.32 sec.
2025-09-09 14:52:05 02421_truncate_isolation_no_merges: [ OK ] 25.04 sec.
2025-09-09 14:52:05 00688_low_cardinality_defaults: [ OK ] 0.52 sec.
2025-09-09 14:52:06 02695_logical_optimizer_alias_bug: [ OK ] 0.32 sec.
2025-09-09 14:52:06 01935_parametrized_query_parametric_aggregate_function: [ OK ] 0.52 sec.
2025-09-09 14:52:07 02241_parquet_bad_column: [ OK ] 3.43 sec.
2025-09-09 14:52:07 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.52 sec.
2025-09-09 14:52:07 02915_analyzer_fuzz_5: [ OK ] 0.32 sec.
2025-09-09 14:52:08 02577_keepermap_delete_update: [ OK ] 0.47 sec.
2025-09-09 14:52:08 00940_order_by_read_in_order: [ OK ] 0.67 sec.
2025-09-09 14:52:09 02995_preliminary_filters_duplicated_columns: [ OK ] 0.32 sec.
2025-09-09 14:52:09 01035_avg: [ OK ] 2.02 sec.
2025-09-09 14:52:09 02149_schema_inference_create_table_syntax: [ OK ] 5.88 sec.
2025-09-09 14:52:09 00239_type_conversion_in_in: [ OK ] 0.32 sec.
2025-09-09 14:52:09 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.42 sec.
2025-09-09 14:52:09 02240_asof_join_biginteger: [ OK ] 0.37 sec.
2025-09-09 14:52:09 00607_index_in_in: [ OK ] 0.42 sec.
2025-09-09 14:52:10 02553_new_type_json_attach_partition: [ OK ] 0.37 sec.
2025-09-09 14:52:10 03443_projection_sparse: [ OK ] 0.47 sec.
2025-09-09 14:52:10 01474_decimal_scale_bug: [ OK ] 0.42 sec.
2025-09-09 14:52:10 00719_parallel_ddl_db: [ OK ] 29.86 sec.
2025-09-09 14:52:11 00564_versioned_collapsing_merge_tree: [ OK ] 5.93 sec.
2025-09-09 14:52:11 03246_alter_update_dynamic_hung: [ OK ] 1.02 sec.
2025-09-09 14:52:11 02941_variant_type_4: [ OK ] 25.58 sec.
2025-09-09 14:52:11 02374_in_tuple_index: [ OK ] 0.32 sec.
2025-09-09 14:52:11 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.52 sec.
2025-09-09 14:52:11 02718_parquet_metadata_format: [ OK ] 1.52 sec.
2025-09-09 14:52:12 02481_xxh3_hash_function: [ OK ] 0.32 sec.
2025-09-09 14:52:12 02950_reading_array_tuple_subcolumns: [ OK ] 0.67 sec.
2025-09-09 14:52:12 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.37 sec.
2025-09-09 14:52:12 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.37 sec.
2025-09-09 14:52:12 00829_bitmap_function: [ OK ] 1.17 sec.
2025-09-09 14:52:12 00393_if_with_constant_condition: [ OK ] 0.42 sec.
2025-09-09 14:52:12 02125_transform_decimal_bug: [ OK ] 0.42 sec.
2025-09-09 14:52:12 01280_null_in: [ OK ] 0.47 sec.
2025-09-09 14:52:12 02918_multif_for_nullable: [ OK ] 1.97 sec.
2025-09-09 14:52:12 01680_date_time_add_ubsan: [ OK ] 0.52 sec.
2025-09-09 14:52:13 00395_nullable: [ OK ] 3.03 sec.
2025-09-09 14:52:13 03001_block_offset_column_2: [ OK ] 0.47 sec.
2025-09-09 14:52:13 02177_merge_optimize_aggregation_in_order: [ OK ] 0.37 sec.
2025-09-09 14:52:13 00467_qualified_names: [ OK ] 0.47 sec.
2025-09-09 14:52:13 02454_create_table_with_custom_disk: [ OK ] 0.42 sec.
2025-09-09 14:52:13 02900_buffer_table_alter_race: [ OK ] 8.74 sec.
2025-09-09 14:52:14 02691_multiple_joins_backtick_identifiers: [ OK ] 0.42 sec.
2025-09-09 14:52:14 00999_nullable_nested_types_4877: [ OK ] 0.47 sec.
2025-09-09 14:52:14 02840_merge__table_or_filter: [ OK ] 0.57 sec.
2025-09-09 14:52:14 01213_alter_table_rename_nested: [ OK ] 0.37 sec.
2025-09-09 14:52:14 00999_settings_no_extra_quotes: [ OK ] 0.32 sec.
2025-09-09 14:52:14 01414_low_cardinality_nullable: [ OK ] 1.62 sec.
2025-09-09 14:52:14 02385_analyzer_aliases_compound_expression: [ OK ] 0.42 sec.
2025-09-09 14:52:14 01389_filter_by_virtual_columns: [ OK ] 0.34 sec.
2025-09-09 14:52:15 02891_alter_update_adaptive_granularity: [ OK ] 0.42 sec.
2025-09-09 14:52:15 03210_nested_short_circuit_functions_bug: [ OK ] 0.37 sec.
2025-09-09 14:52:15 02680_default_star: [ OK ] 0.32 sec.
2025-09-09 14:52:15 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.37 sec.
2025-09-09 14:52:15 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.32 sec.
2025-09-09 14:52:15 00837_minmax_index: [ OK ] 3.03 sec.
2025-09-09 14:52:15 01343_min_bytes_to_use_mmap_io: [ OK ] 0.62 sec.
2025-09-09 14:52:15 02714_async_inserts_empty_data: [ OK ] 2.72 sec.
2025-09-09 14:52:15 01040_h3_get_resolution: [ OK ] 0.32 sec.
2025-09-09 14:52:15 01605_key_condition_enum_int: [ OK ] 0.37 sec.
2025-09-09 14:52:15 02595_orc_arrow_parquet_more_types: [ OK ] 1.47 sec.
2025-09-09 14:52:15 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.32 sec.
2025-09-09 14:52:16 02424_pod_array_overflow: [ OK ] 0.27 sec.
2025-09-09 14:52:16 02016_bit_shift_right_for_string_integer: [ OK ] 0.77 sec.
2025-09-09 14:52:16 03201_avro_negative_block_size_arrays: [ OK ] 0.77 sec.
2025-09-09 14:52:16 02020_exponential_smoothing: [ OK ] 1.17 sec.
2025-09-09 14:52:17 00429_point_in_ellipses: [ OK ] 0.32 sec.
2025-09-09 14:52:17 01456_modify_column_type_via_add_drop_update: [ OK ] 0.72 sec.
2025-09-09 14:52:17 02160_h3_cell_area_m2: [ OK ] 0.37 sec.
2025-09-09 14:52:17 01471_with_format: [ OK ] 0.32 sec.
2025-09-09 14:52:17 01497_now_support_timezone: [ OK ] 0.32 sec.
2025-09-09 14:52:17 02984_form_format: [ OK ] 2.07 sec.
2025-09-09 14:52:18 02785_left_anti_join_bug: [ OK ] 0.52 sec.
2025-09-09 14:52:18 00860_unknown_identifier_bug: [ OK ] 0.42 sec.
2025-09-09 14:52:18 02711_server_uuid_macro: [ OK ] 0.47 sec.
2025-09-09 14:52:18 03015_with_fill_invalid_expression: [ OK ] 0.37 sec.
2025-09-09 14:52:18 00500_point_in_polygon_non_const_poly: [ OK ] 0.92 sec.
2025-09-09 14:52:19 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.42 sec.
2025-09-09 14:52:19 03120_analyzer_param_in_CTE_alias: [ OK ] 0.32 sec.
2025-09-09 14:52:19 02205_postgresql_functions: [ OK ] 0.72 sec.
2025-09-09 14:52:19 02319_sql_standard_create_drop_index: [ OK ] 0.42 sec.
2025-09-09 14:52:19 00564_temporary_table_management: [ OK ] 0.27 sec.
2025-09-09 14:52:19 03215_grant_current_grants: [ OK ] 3.07 sec.
2025-09-09 14:52:19 00482_subqueries_and_aliases: [ OK ] 0.37 sec.
2025-09-09 14:52:19 01123_parse_date_time_best_effort_even_more: [ OK ] 0.42 sec.
2025-09-09 14:52:20 02915_analyzer_fuzz_1: [ OK ] 0.32 sec.
2025-09-09 14:52:20 02674_date_int_string_json_inference: [ OK ] 0.32 sec.
2025-09-09 14:52:20 03013_repeat_with_nonnative_integers: [ OK ] 0.37 sec.
2025-09-09 14:52:20 02574_suspicious_low_cardinality_msan: [ OK ] 0.47 sec.
2025-09-09 14:52:20 01354_order_by_tuple_collate_const: [ OK ] 0.42 sec.
2025-09-09 14:52:20 03060_analyzer_regular_view_alias: [ OK ] 0.37 sec.
2025-09-09 14:52:20 01891_partition_by_uuid: [ OK ] 0.37 sec.
2025-09-09 14:52:21 02987_group_array_intersect: [ OK ] 1.37 sec.
2025-09-09 14:52:21 01720_country_perimeter_and_area: [ OK ] 5.33 sec.
2025-09-09 14:52:21 02026_arrayDifference_const: [ OK ] 0.32 sec.
2025-09-09 14:52:21 02874_json_merge_patch_function_test: [ OK ] 0.42 sec.
2025-09-09 14:52:21 01025_array_compact_generic: [ OK ] 0.37 sec.
2025-09-09 14:52:21 02881_system_detached_parts_modification_time: [ OK ] 0.47 sec.
2025-09-09 14:52:21 03152_dynamic_type_simple: [ OK ] 0.42 sec.
2025-09-09 14:52:21 01611_string_to_low_cardinality_key_alter: [ OK ] 0.42 sec.
2025-09-09 14:52:21 02923_join_use_nulls_modulo: [ OK ] 0.32 sec.
2025-09-09 14:52:22 00229_prewhere_column_missing: [ OK ] 0.42 sec.
2025-09-09 14:52:22 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.42 sec.
2025-09-09 14:52:22 00938_fix_rwlock_segfault_long: [ SKIPPED ] 0.00 sec.
2025-09-09 14:52:22 Reason: not running for current build
2025-09-09 14:52:22 01780_column_sparse_full: [ OK ] 0.87 sec.
2025-09-09 14:52:22 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 2.32 sec.
2025-09-09 14:52:22 01330_array_join_in_higher_order_function: [ OK ] 0.32 sec.
2025-09-09 14:52:22 02972_to_string_nullable_timezone: [ OK ] 0.37 sec.
2025-09-09 14:52:22 02882_primary_key_index_in_function_different_types: [ OK ] 0.37 sec.
2025-09-09 14:52:22 01674_unicode_asan: [ OK ] 0.42 sec.
2025-09-09 14:52:23 03034_normalized_ast: [ OK ] 0.42 sec.
2025-09-09 14:52:23 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.72 sec.
2025-09-09 14:52:23 00578_merge_table_sampling: [ OK ] 0.52 sec.
2025-09-09 14:52:23 00944_ml_test: [ OK ] 0.42 sec.
2025-09-09 14:52:24 00038_totals_limit: [ OK ] 0.32 sec.
2025-09-09 14:52:24 02429_low_cardinality_trash: [ OK ] 0.62 sec.
2025-09-09 14:52:24 03135_keeper_client_find_commands: [ OK ] 1.13 sec.
2025-09-09 14:52:24 01444_create_table_drop_database_race: [ OK ] 10.90 sec.
2025-09-09 14:52:24 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.42 sec.
2025-09-09 14:52:24 02531_ipv4_arithmetic: [ OK ] 0.32 sec.
2025-09-09 14:52:25 01761_cast_to_enum_nullable: [ OK ] 0.42 sec.
2025-09-09 14:52:25 01300_group_by_other_keys_having: [ OK ] 1.42 sec.
2025-09-09 14:52:26 02983_empty_map: [ OK ] 0.57 sec.
2025-09-09 14:52:27 01156_pcg_deserialization: [ OK ] 11.05 sec.
2025-09-09 14:52:27 01799_long_uniq_theta_sketch: [ OK ] 2.47 sec.
2025-09-09 14:52:27 02792_drop_projection_lwd: [ OK ] 0.53 sec.
2025-09-09 14:52:28 02963_remote_read_small_buffer_size_bug: [ OK ] 5.49 sec.
2025-09-09 14:52:28 02687_native_fuzz: [ OK ] 0.44 sec.
2025-09-09 14:52:28 01262_low_cardinality_remove: [ OK ] 0.42 sec.
2025-09-09 14:52:28 00160_merge_and_index_in_in: [ OK ] 6.49 sec.
2025-09-09 14:52:28 02766_prql: [ OK ] 2.58 sec.
2025-09-09 14:52:28 03217_fliter_pushdown_no_keys: [ OK ] 0.42 sec.
2025-09-09 14:52:28 00063_check_query: [ OK ] 0.52 sec.
2025-09-09 14:52:28 01278_format_multiple_queries: [ OK ] 0.72 sec.
2025-09-09 14:52:29 00502_string_concat_with_array: [ OK ] 0.42 sec.
2025-09-09 14:52:29 01910_view_dictionary_check_refresh: [ OK ] 24.48 sec.
2025-09-09 14:52:29 01788_update_nested_type_subcolumn_check: [ OK ] 0.87 sec.
2025-09-09 14:52:29 02710_protobuf_ipv4_date32: [ OK ] 1.28 sec.
2025-09-09 14:52:30 02119_sumcount: [ OK ] 0.68 sec.
2025-09-09 14:52:30 02039_group_by_with_totals_having: [ OK ] 0.32 sec.
2025-09-09 14:52:30 02001_append_output_file: [ OK ] 1.18 sec.
2025-09-09 14:52:30 01095_tpch_like_smoke: [ OK ] 0.92 sec.
2025-09-09 14:52:30 00227_quantiles_timing_arbitrary_order: [ OK ] 0.42 sec.
2025-09-09 14:52:30 01098_sum: [ OK ] 0.42 sec.
2025-09-09 14:52:30 01710_minmax_count_projection_distributed_query: [ OK ] 0.44 sec.
2025-09-09 14:52:30 02155_dictionary_comment: [ OK ] 0.67 sec.
2025-09-09 14:52:30 02707_analyzer_nested_lambdas_types: [ OK ] 0.37 sec.
2025-09-09 14:52:31 00307_format_xml: [ OK ] 0.38 sec.
2025-09-09 14:52:31 00608_uniq_array: [ OK ] 0.53 sec.
2025-09-09 14:52:31 02875_show_functions: [ OK ] 1.77 sec.
2025-09-09 14:52:31 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.47 sec.
2025-09-09 14:52:31 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.32 sec.
2025-09-09 14:52:31 01091_insert_with_default_json: [ OK ] 0.39 sec.
2025-09-09 14:52:31 01621_summap_check_types: [ OK ] 0.38 sec.
2025-09-09 14:52:31 00927_asof_join_noninclusive: [ OK ] 0.52 sec.
2025-09-09 14:52:31 02534_join_prewhere_bug: [ OK ] 0.57 sec.
2025-09-09 14:52:32 01949_heredoc_unfinished: [ OK ] 0.67 sec.
2025-09-09 14:52:32 01490_nullable_string_to_enum: [ OK ] 0.32 sec.
2025-09-09 14:52:32 02935_ipv6_bit_operations: [ OK ] 0.32 sec.
2025-09-09 14:52:32 02902_add_scalar_in_all_case: [ OK ] 0.42 sec.
2025-09-09 14:52:32 01497_mutation_support_for_storage_memory: [ OK ] 0.37 sec.
2025-09-09 14:52:32 02131_row_policies_combination: [ OK ] 0.57 sec.
2025-09-09 14:52:33 03093_reading_bug_with_parallel_replicas: [ OK ] 0.54 sec.
2025-09-09 14:52:33 03142_untuple_crash: [ OK ] 0.32 sec.
2025-09-09 14:52:33 02864_filtered_url_with_globs: [ OK ] 0.37 sec.
2025-09-09 14:52:33 03169_modify_column_data_loss: [ OK ] 0.42 sec.
2025-09-09 14:52:33 01825_type_json_8: [ OK ] 3.14 sec.
2025-09-09 14:52:34 01621_bar_nan_arguments: [ OK ] 0.32 sec.
2025-09-09 14:52:34 03149_variant_pop_back_typo: [ OK ] 0.33 sec.
2025-09-09 14:52:34 02560_regexp_denial_of_service: [ OK ] 0.72 sec.
2025-09-09 14:52:34 01785_pmj_lc_bug: [ OK ] 0.42 sec.
2025-09-09 14:52:34 00048_b_stored_aggregates_merge: [ OK ] 0.42 sec.
2025-09-09 14:52:35 02841_not_ready_set_bug: [ OK ] 2.98 sec.
2025-09-09 14:52:35 00688_low_cardinality_syntax: [ OK ] 0.53 sec.
2025-09-09 14:52:35 01508_format_regexp_raw: [ OK ] 1.47 sec.
2025-09-09 14:52:35 02129_window_functions_disable_optimizations: [ OK ] 0.37 sec.
2025-09-09 14:52:36 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.28 sec.
2025-09-09 14:52:36 03313_case_insensitive_json_type_declaration: [ OK ] 0.39 sec.
2025-09-09 14:52:36 02841_group_array_sorted: [ OK ] 0.87 sec.
2025-09-09 14:52:36 00308_write_buffer_valid_utf8: [ OK ] 0.37 sec.
2025-09-09 14:52:36 02681_undrop_query_uuid: [ OK ] 4.14 sec.
2025-09-09 14:52:36 01922_array_join_with_index: [ OK ] 0.47 sec.
2025-09-09 14:52:36 01461_query_start_time_microseconds: [ OK ] 0.73 sec.
2025-09-09 14:52:36 02918_join_pm_lc_crash: [ OK ] 0.42 sec.
2025-09-09 14:52:37 00700_decimal_null: [ OK ] 0.58 sec.
2025-09-09 14:52:37 03013_ignore_drop_queries_probability: [ OK ] 0.37 sec.
2025-09-09 14:52:37 01521_max_length_alias: [ OK ] 0.47 sec.
2025-09-09 14:52:37 02464_decimal_scale_buffer_overflow: [ OK ] 0.32 sec.
2025-09-09 14:52:37 00937_ipv4_cidr_range: [ OK ] 0.42 sec.
2025-09-09 14:52:37 00098_j_union_all: [ OK ] 0.37 sec.
2025-09-09 14:52:38 01771_datetime64_no_time_part: [ OK ] 0.43 sec.
2025-09-09 14:52:38 01699_timezoneOffset: [ OK ] 0.62 sec.
2025-09-09 14:52:38 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.42 sec.
2025-09-09 14:52:38 01514_empty_buffer_different_types: [ OK ] 0.37 sec.
2025-09-09 14:52:38 02561_sorting_constants_and_distinct_crash: [ OK ] 2.04 sec.
2025-09-09 14:52:39 01451_detach_drop_part: [ OK ] 0.57 sec.
2025-09-09 14:52:39 02737_sql_auto_is_null: [ OK ] 0.33 sec.
2025-09-09 14:52:39 01663_aes_msan: [ OK ] 0.37 sec.
2025-09-09 14:52:39 02782_values_null_to_lc_nullable: [ OK ] 0.47 sec.
2025-09-09 14:52:39 02015_async_inserts_1: [ OK ] 1.78 sec.
2025-09-09 14:52:39 01655_agg_if_nullable: [ OK ] 0.42 sec.
2025-09-09 14:52:40 00968_roundAge: [ OK ] 0.37 sec.
2025-09-09 14:52:40 01720_union_distinct_with_limit: [ OK ] 0.32 sec.
2025-09-09 14:52:40 02532_send_logs_level_test: [ SKIPPED ] 0.00 sec.
2025-09-09 14:52:40 Reason: not running for current build
2025-09-09 14:52:40 00900_orc_arrow_parquet_maps: [ OK ] 5.74 sec.
2025-09-09 14:52:40 02995_index_3: [ SKIPPED ] 0.00 sec.
2025-09-09 14:52:40 Reason: not running for current build
2025-09-09 14:52:40 01421_assert_in_in: [ OK ] 0.37 sec.
2025-09-09 14:52:40 03105_table_aliases_in_mv: [ OK ] 0.53 sec.
2025-09-09 14:52:41 01427_pk_and_expression_with_different_type: [ OK ] 0.33 sec.
2025-09-09 14:52:41 00380_client_break_at_exception_in_batch_mode: [ OK ] 0.82 sec.
2025-09-09 14:52:41 02813_float_parsing: [ OK ] 0.37 sec.
2025-09-09 14:52:42 02872_null_as_default_nested: [ OK ] 4.34 sec.
2025-09-09 14:52:42 01056_predicate_optimizer_bugs: [ OK ] 0.67 sec.
2025-09-09 14:52:43 00702_join_on_dups: [ OK ] 0.72 sec.
2025-09-09 14:52:43 02455_default_union_except_intersect: [ OK ] 0.68 sec.
2025-09-09 14:52:44 02488_zero_copy_detached_parts_drop_table: [ OK ] 4.28 sec.
2025-09-09 14:52:44 02870_per_column_settings: [ OK ] 0.57 sec.
2025-09-09 14:52:44 01165_lost_part_empty_partition: [ OK ] 3.48 sec.
2025-09-09 14:52:45 02389_analyzer_nested_lambda: [ OK ] 4.73 sec.
2025-09-09 14:52:45 02341_global_join_cte: [ OK ] 0.54 sec.
2025-09-09 14:52:46 01834_alias_columns_laziness_filimonov: [ OK ] 1.62 sec.
2025-09-09 14:52:46 02560_vertical_merge_memory_usage: [ OK ] 2.63 sec.
2025-09-09 14:52:46 00904_array_with_constant_2: [ OK ] 0.43 sec.
2025-09-09 14:52:47 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.57 sec.
2025-09-09 14:52:47 02457_parse_date_time_best_effort: [ OK ] 0.67 sec.
2025-09-09 14:52:47 02801_backup_native_copy: [ OK ] 5.03 sec.
2025-09-09 14:52:47 01917_system_data_skipping_indices: [ OK ] 0.42 sec.
2025-09-09 14:52:47 02493_max_streams_for_merge_tree_reading: [ OK ] 2.18 sec.
2025-09-09 14:52:48 01301_polygons_within: [ OK ] 0.52 sec.
2025-09-09 14:52:48 02725_cnf_large_check: [ OK ] 0.73 sec.
2025-09-09 14:52:48 01892_setting_limit_offset_distributed: [ OK ] 0.42 sec.
2025-09-09 14:52:48 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.32 sec.
2025-09-09 14:52:49 01280_min_map_max_map: [ OK ] 0.57 sec.
2025-09-09 14:52:49 02982_create_mv_inner_extra: [ OK ] 0.42 sec.
2025-09-09 14:52:50 01600_quota_by_forwarded_ip: [ OK ] 1.37 sec.
2025-09-09 14:52:50 00368_format_option_collision: [ OK ] 0.97 sec.
2025-09-09 14:52:51 02952_clickhouse_local_query_parameters_cli: [ OK ] 0.72 sec.
2025-09-09 14:52:51 01710_projection_optimize_materialize: [ OK ] 0.77 sec.
2025-09-09 14:52:51 02555_davengers_rename_chain: [ OK ] 3.88 sec.
2025-09-09 14:52:51 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec.
2025-09-09 14:52:51 Reason: not running for current build
2025-09-09 14:52:51 01090_fixed_string_bit_ops: [ OK ] 0.39 sec.
2025-09-09 14:52:52 01284_escape_sequences_php_mysql_style: [ OK ] 0.43 sec.
2025-09-09 14:52:52 01774_bar_with_illegal_value: [ OK ] 0.32 sec.
2025-09-09 14:52:52 00540_bad_data_types: [ OK ] 5.44 sec.
2025-09-09 14:52:53 02932_idna: [ OK ] 1.23 sec.
2025-09-09 14:52:53 01453_normalize_query_alias_uuid: [ OK ] 0.37 sec.
2025-09-09 14:52:53 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec.
2025-09-09 14:52:53 Reason: not running for current build
2025-09-09 14:52:53 02458_empty_hdfs_url: [ OK ] 0.48 sec.
2025-09-09 14:52:53 03160_dynamic_type_agg: [ OK ] 0.38 sec.
2025-09-09 14:52:53 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.39 sec.
2025-09-09 14:52:53 03158_dynamic_type_from_variant: [ OK ] 0.42 sec.
2025-09-09 14:52:54 00862_decimal_in: [ OK ] 0.63 sec.
2025-09-09 14:52:54 00450_higher_order_and_nullable: [ OK ] 0.37 sec.
2025-09-09 14:52:54 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.47 sec.
2025-09-09 14:52:54 01499_log_deadlock: [ OK ] 0.42 sec.
2025-09-09 14:52:55 00930_arrayIntersect: [ OK ] 0.52 sec.
2025-09-09 14:52:55 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ OK ] 31.38 sec.
2025-09-09 14:52:55 02301_harmful_reexec: [ OK ] 0.77 sec.
2025-09-09 14:52:56 01838_system_dictionaries_virtual_key_column: [ OK ] 0.42 sec.
2025-09-09 14:52:56 00632_get_sample_block_cache: [ OK ] 2.02 sec.
2025-09-09 14:52:56 00746_hashing_tuples: [ OK ] 0.72 sec.
2025-09-09 14:52:57 02097_initializeAggregationNullable: [ OK ] 0.37 sec.
2025-09-09 14:52:57 01049_join_low_card_crash: [ OK ] 0.48 sec.
2025-09-09 14:52:57 03085_analyzer_alias_column_group_by: [ OK ] 0.32 sec.
2025-09-09 14:52:58 02922_server_exit_code: [ OK ] 0.87 sec.
2025-09-09 14:52:58 00953_constraints_operations: [ OK ] 4.58 sec.
2025-09-09 14:52:58 01318_encrypt: [ OK ] 0.98 sec.
2025-09-09 14:52:58 01600_encode_XML: [ OK ] 0.37 sec.
2025-09-09 14:52:58 01318_map_populate_series: [ OK ] 0.62 sec.
2025-09-09 14:52:58 02680_illegal_type_of_filter_projection: [ OK ] 0.42 sec.
2025-09-09 14:52:59 02370_analyzer_in_function: [ OK ] 0.57 sec.
2025-09-09 14:52:59 01383_log_broken_table: [ OK ] 30.54 sec.
2025-09-09 14:52:59 00566_enum_min_max: [ OK ] 0.33 sec.
2025-09-09 14:52:59 01787_arena_assert_column_nothing: [ OK ] 0.32 sec.
2025-09-09 14:52:59 01825_type_json_3: [ OK ] 0.72 sec.
2025-09-09 14:52:59 01070_alter_with_ttl: [ OK ] 0.32 sec.
2025-09-09 14:53:00 00800_low_cardinality_merge_join: [ OK ] 1.22 sec.
2025-09-09 14:53:00 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.37 sec.
2025-09-09 14:53:00 02554_format_json_columns_for_empty: [ OK ] 0.32 sec.
2025-09-09 14:53:00 01231_operator_null_in: [ OK ] 1.83 sec.
2025-09-09 14:53:00 02375_pretty_formats: [ OK ] 0.44 sec.
2025-09-09 14:53:01 02128_cast_nullable: [ OK ] 0.37 sec.
2025-09-09 14:53:01 02042_map_get_non_const_key: [ OK ] 0.37 sec.
2025-09-09 14:53:01 02539_vertical_merge_compact_parts: [ OK ] 1.48 sec.
2025-09-09 14:53:01 02416_rocksdb_delete_update: [ OK ] 0.57 sec.
2025-09-09 14:53:01 02319_dict_get_check_arguments_size: [ OK ] 0.57 sec.
2025-09-09 14:53:01 02045_like_function: [ OK ] 0.38 sec.
2025-09-09 14:53:02 03035_dynamic_sorting: [ OK ] 0.57 sec.
2025-09-09 14:53:02 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.32 sec.
2025-09-09 14:53:03 02354_read_in_order_prewhere: [ OK ] 1.37 sec.
2025-09-09 14:53:04 03038_nested_dynamic_merges_wide_horizontal: [ OK ] 3.78 sec.
2025-09-09 14:53:05 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 2.13 sec.
2025-09-09 14:53:05 02515_projections_with_totals: [ OK ] 0.42 sec.
2025-09-09 14:53:06 02267_insert_empty_data: [ OK ] 0.27 sec.
2025-09-09 14:53:06 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 1.97 sec.
2025-09-09 14:53:06 01317_no_password_in_command_line: [ OK ] 4.79 sec.
2025-09-09 14:53:06 02811_primary_key_in_columns: [ OK ] 0.53 sec.
2025-09-09 14:53:07 02295_GROUP_BY_AggregateFunction: [ OK ] 0.53 sec.
2025-09-09 14:53:07 02995_index_10: [ SKIPPED ] 0.00 sec.
2025-09-09 14:53:07 Reason: not running for current build
2025-09-09 14:53:07 00804_rollup_with_having: [ OK ] 0.47 sec.
2025-09-09 14:53:07 02962_parallel_window_functions_different_partitioning: [ OK ] 0.52 sec.
2025-09-09 14:53:07 01544_file_engine_settings: [ OK ] 1.02 sec.
2025-09-09 14:53:07 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2025-09-09 14:53:07 Reason: not running for current build
2025-09-09 14:53:07 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.37 sec.
2025-09-09 14:53:08 01143_trivial_count_with_join: [ OK ] 0.53 sec.
2025-09-09 14:53:08 00814_parsing_ub: [ OK ] 0.32 sec.
2025-09-09 14:53:08 03038_ambiguous_column: [ OK ] 0.32 sec.
2025-09-09 14:53:08 01902_table_function_merge_db_params: [ OK ] 0.63 sec.
2025-09-09 14:53:09 00842_array_with_constant_overflow: [ OK ] 0.38 sec.
2025-09-09 14:53:09 00030_alter_table: [ OK ] 0.62 sec.
2025-09-09 14:53:10 02703_max_local_read_bandwidth: [ OK ] 25.78 sec.
2025-09-09 14:53:10 00155_long_merges: [ SKIPPED ] 0.00 sec.
2025-09-09 14:53:10 Reason: not running for current build
2025-09-09 14:53:10 01595_countMatches: [ OK ] 0.52 sec.
2025-09-09 14:53:10 02366_kql_native_interval_format: [ OK ] 0.42 sec.
2025-09-09 14:53:10 01045_bloom_filter_null_array: [ OK ] 0.42 sec.
2025-09-09 14:53:10 02908_table_ttl_dependency: [ OK ] 1.73 sec.
2025-09-09 14:53:11 03115_alias_exists_column: [ OK ] 0.37 sec.
2025-09-09 14:53:11 02724_mutliple_storage_join: [ OK ] 0.37 sec.
2025-09-09 14:53:11 01019_alter_materialized_view_atomic: [ SKIPPED ] 0.00 sec.
2025-09-09 14:53:11 Reason: not running for current build
2025-09-09 14:53:11 01419_merge_tree_settings_sanity_check: [ OK ] 0.67 sec.
2025-09-09 14:53:11 02041_openssl_hash_functions_test: [ OK ] 0.42 sec.
2025-09-09 14:53:11 01107_join_right_table_totals: [ OK ] 0.52 sec.
2025-09-09 14:53:12 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 21.22 sec.
2025-09-09 14:53:12 00688_low_cardinality_in: [ OK ] 0.42 sec.
2025-09-09 14:53:12 01086_window_view_cleanup: [ OK ] 5.74 sec.
2025-09-09 14:53:12 03151_external_cross_join: [ OK ] 1.62 sec.
2025-09-09 14:53:13 02861_interpolate_alias_precedence: [ OK ] 0.32 sec.
2025-09-09 14:53:13 00956_join_use_nulls_with_array_column: [ OK ] 0.37 sec.
2025-09-09 14:53:13 02995_index_5: [ SKIPPED ] 0.00 sec.
2025-09-09 14:53:13 Reason: not running for current build
2025-09-09 14:53:13 01273_arrow_load: [ OK ] 1.92 sec.
2025-09-09 14:53:13 02842_one_input_format: [ OK ] 2.13 sec.
2025-09-09 14:53:13 02786_parquet_big_integer_compatibility: [ OK ] 0.82 sec.
2025-09-09 14:53:13 02699_polygons_sym_difference_rollup: [ OK ] 0.37 sec.
2025-09-09 14:53:13 00268_aliases_without_as_keyword: [ OK ] 0.32 sec.
2025-09-09 14:53:14 02807_lower_utf8_msan: [ OK ] 0.37 sec.
2025-09-09 14:53:14 02724_function_in_left_table_clause_asof_join: [ OK ] 0.37 sec.
2025-09-09 14:53:14 02884_string_distance_function: [ OK ] 0.67 sec.
2025-09-09 14:53:14 02554_log_faminy_support_storage_policy: [ OK ] 0.47 sec.
2025-09-09 14:53:14 00908_bloom_filter_index: [ OK ] 18.93 sec.
2025-09-09 14:53:14 01710_projection_group_by_order_by: [ OK ] 0.22 sec.
2025-09-09 14:53:15 01554_row_number_after_cannot_read_all_data: [ OK ] 0.82 sec.
2025-09-09 14:53:15 00938_dataset_test: [ OK ] 0.37 sec.
2025-09-09 14:53:15 00910_decimal_group_array_crash_3783: [ OK ] 0.52 sec.
2025-09-09 14:53:15 02352_grouby_shadows_arg: [ OK ] 0.37 sec.
2025-09-09 14:53:15 00464_array_element_out_of_range: [ OK ] 0.37 sec.
2025-09-09 14:53:16 00339_parsing_bad_arrays: [ OK ] 0.67 sec.
2025-09-09 14:53:16 01787_map_remote: [ OK ] 0.37 sec.
2025-09-09 14:53:16 01063_create_column_set: [ OK ] 0.37 sec.
2025-09-09 14:53:16 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.37 sec.
2025-09-09 14:53:16 01720_join_implicit_cast: [ OK ] 1.07 sec.
2025-09-09 14:53:17 01072_select_constant_limit: [ OK ] 0.32 sec.
2025-09-09 14:53:17 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 0.67 sec.
2025-09-09 14:53:17 01666_date_lut_buffer_overflow: [ OK ] 0.33 sec.
2025-09-09 14:53:17 01851_hedged_connections_external_tables: [ OK ] 0.47 sec.
2025-09-09 14:53:18 02242_make_date_mysql: [ OK ] 0.52 sec.
2025-09-09 14:53:18 02296_nullable_arguments_in_array_filter: [ OK ] 0.47 sec.
2025-09-09 14:53:18 01780_column_sparse_pk: [ OK ] 0.47 sec.
2025-09-09 14:53:18 02366_kql_distinct: [ OK ] 0.42 sec.
2025-09-09 14:53:18 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.37 sec.
2025-09-09 14:53:19 01413_if_array_uuid: [ OK ] 0.32 sec.
2025-09-09 14:53:19 01825_type_json_missed_values: [ OK ] 0.42 sec.
2025-09-09 14:53:19 02560_quantile_min_max: [ OK ] 0.32 sec.
2025-09-09 14:53:19 01825_new_type_json_12: [ OK ] 3.69 sec.
2025-09-09 14:53:20 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.37 sec.
2025-09-09 14:53:20 02354_with_statement_non_exist_column: [ OK ] 0.32 sec.
2025-09-09 14:53:20 02575_merge_prewhere_materialized: [ OK ] 0.37 sec.
2025-09-09 14:53:22 00823_capnproto_input: [ OK ] 1.98 sec.
2025-09-09 14:53:22 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 8.70 sec.
2025-09-09 14:53:23 00416_pocopatch_progress_in_http_headers: [ OK ] 0.82 sec.
2025-09-09 14:53:23 03287_dynamic_and_json_squashing_fix: [ OK ] 0.47 sec.
2025-09-09 14:53:23 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 4.13 sec.
2025-09-09 14:53:23 00411_merge_tree_where_const_in_set: [ OK ] 0.37 sec.
2025-09-09 14:53:23 01780_column_sparse_filter: [ OK ] 0.42 sec.
2025-09-09 14:53:23 03073_analyzer_alias_as_column_name: [ OK ] 0.32 sec.
2025-09-09 14:53:23 01782_field_oom: [ OK ] 3.53 sec.
2025-09-09 14:53:24 02932_query_settings_max_size_drop: [ OK ] 0.47 sec.
2025-09-09 14:53:24 00506_shard_global_in_union: [ OK ] 0.47 sec.
2025-09-09 14:53:24 00726_length_aliases: [ OK ] 0.32 sec.
2025-09-09 14:53:24 02916_replication_protocol_wait_for_part: [ OK ] 10.51 sec.
2025-09-09 14:53:24 02496_remove_redundant_sorting: [ OK ] 12.10 sec.
2025-09-09 14:53:25 01783_parallel_formatting_memory: [ OK ] 0.72 sec.
2025-09-09 14:53:25 01802_toDateTime64_large_values: [ OK ] 0.32 sec.
2025-09-09 14:53:25 01319_query_formatting_in_server_log: [ OK ] 1.13 sec.
2025-09-09 14:53:25 02409_url_format_detection: [ OK ] 0.32 sec.
2025-09-09 14:53:25 02122_parallel_formatting_Values: [ OK ] 2.03 sec.
2025-09-09 14:53:25 01797_StripeLog_rwlock_ub: [ OK ] 0.37 sec.
2025-09-09 14:53:26 01001_enums_in_in_section: [ OK ] 0.32 sec.
2025-09-09 14:53:26 02142_http_with_query_parameters: [ OK ] 0.63 sec.
2025-09-09 14:53:26 02346_into_outfile_and_stdout: [ OK ] 2.98 sec.
2025-09-09 14:53:26 01825_new_type_json_in_array: [ OK ] 0.52 sec.
2025-09-09 14:53:26 01390_remove_injective_in_uniq: [ OK ] 0.44 sec.
2025-09-09 14:53:27 00757_enum_defaults_const: [ OK ] 0.32 sec.
2025-09-09 14:53:27 01307_polygon_perimeter: [ OK ] 0.32 sec.
2025-09-09 14:53:27 02903_client_insert_in_background: [ OK ] 1.83 sec.
2025-09-09 14:53:27 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 0.73 sec.
2025-09-09 14:53:27 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.37 sec.
2025-09-09 14:53:27 01576_alter_low_cardinality_and_select: [ OK ] 3.53 sec.
2025-09-09 14:53:27 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.37 sec.
2025-09-09 14:53:28 02894_ast_depth_check: [ OK ] 0.93 sec.
2025-09-09 14:53:28 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.42 sec.
2025-09-09 14:53:28 01065_if_not_finite: [ OK ] 0.42 sec.
2025-09-09 14:53:28 02146_mv_non_phys: [ OK ] 0.32 sec.
2025-09-09 14:53:28 01656_sequence_next_node_long: [ OK ] 3.43 sec.
2025-09-09 14:53:28 02833_local_with_dialect: [ OK ] 1.07 sec.
2025-09-09 14:53:28 03290_final_collapsing: [ OK ] 0.52 sec.
2025-09-09 14:53:29 02160_h3_hex_area_Km2: [ OK ] 0.47 sec.
2025-09-09 14:53:29 02797_range_nullable: [ OK ] 0.68 sec.
2025-09-09 14:53:30 01324_settings_documentation: [ OK ] 0.59 sec.
2025-09-09 14:53:31 01778_where_with_column_name: [ OK ] 0.68 sec.
2025-09-09 14:53:31 02122_parallel_formatting_JSONEachRow: [ OK ] 3.74 sec.
2025-09-09 14:53:31 01671_aggregate_function_group_bitmap_data: [ OK ] 0.78 sec.
2025-09-09 14:53:32 03111_inner_join_group_by: [ OK ] 0.48 sec.
2025-09-09 14:53:32 02959_system_database_engines: [ OK ] 0.62 sec.
2025-09-09 14:53:32 00900_long_parquet: [ OK ] 30.23 sec.
2025-09-09 14:53:33 00700_decimal_defaults: [ OK ] 0.89 sec.
2025-09-09 14:53:33 00729_prewhere_array_join: [ OK ] 1.08 sec.
2025-09-09 14:53:34 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 1.69 sec.
2025-09-09 14:53:34 00746_compile_non_deterministic_function: [ OK ] 6.39 sec.
2025-09-09 14:53:34 02861_filter_pushdown_const_bug: [ OK ] 0.74 sec.
2025-09-09 14:53:34 00938_test_retention_function: [ OK ] 0.90 sec.
2025-09-09 14:53:35 02126_fix_filelog: [ OK ] 5.96 sec.
2025-09-09 14:53:35 03011_adaptative_timeout_compatibility: [ OK ] 0.64 sec.
2025-09-09 14:53:35 02677_grace_hash_limit_race: [ OK ] 0.69 sec.
2025-09-09 14:53:35 02888_obsolete_settings: [ OK ] 0.59 sec.
2025-09-09 14:53:36 00742_require_join_strictness: [ OK ] 0.68 sec.
2025-09-09 14:53:36 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.65 sec.
2025-09-09 14:53:36 01714_alter_drop_version: [ OK ] 0.55 sec.
2025-09-09 14:53:36 01186_conversion_to_nullable: [ OK ] 0.60 sec.
2025-09-09 14:53:37 02982_unambiguous_alter_commands: [ OK ] 0.53 sec.
2025-09-09 14:53:37 02731_parallel_replicas_join_subquery: [ OK ] 2.53 sec.
2025-09-09 14:53:37 00973_uniq_non_associativity: [ OK ] 1.95 sec.
2025-09-09 14:53:38 02887_format_readable_timedelta_subseconds: [ OK ] 0.58 sec.
2025-09-09 14:53:38 01104_distributed_numbers_test: [ OK ] 0.84 sec.
2025-09-09 14:53:39 02343_analyzer_column_transformers_strict: [ OK ] 0.93 sec.
2025-09-09 14:53:39 02378_part_log_profile_events: [ OK ] 3.05 sec.
2025-09-09 14:53:39 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.97 sec.
2025-09-09 14:53:40 02910_replicated_merge_parameters_must_consistent: [ OK ] 1.04 sec.
2025-09-09 14:53:40 00555_right_join_excessive_rows: [ OK ] 0.63 sec.
2025-09-09 14:53:40 01691_DateTime64_clamp: [ OK ] 0.64 sec.
2025-09-09 14:53:41 02473_extract_low_cardinality_from_json: [ OK ] 0.75 sec.
2025-09-09 14:53:41 02967_fuzz_bad_cast: [ OK ] 0.53 sec.
2025-09-09 14:53:41 00829_bitmap64_function: [ OK ] 0.93 sec.
2025-09-09 14:53:42 02867_null_lc_in_bug: [ OK ] 0.65 sec.
2025-09-09 14:53:42 02006_todatetime64_from_string: [ OK ] 0.38 sec.
2025-09-09 14:53:43 00825_http_header_query_id: [ OK ] 1.40 sec.
2025-09-09 14:53:43 00951_ngram_search: [ OK ] 2.49 sec.
2025-09-09 14:53:43 01430_modify_sample_by_zookeeper_long: [ OK ] 1.53 sec.
2025-09-09 14:53:44 00338_replicate_array_of_strings: [ OK ] 0.83 sec.
2025-09-09 14:53:44 01600_min_max_compress_block_size: [ OK ] 0.70 sec.
2025-09-09 14:53:45 02212_h3_get_pentagon_indexes: [ OK ] 0.67 sec.
2025-09-09 14:53:45 00981_topK_topKWeighted_long: [ OK ] 16.59 sec.
2025-09-09 14:53:45 03038_move_partition_to_oneself_deadlock: [ OK ] 0.79 sec.
2025-09-09 14:53:45 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.50 sec.
2025-09-09 14:53:46 00700_decimal_casts: [ OK ] 2.26 sec.
2025-09-09 14:53:46 02526_kv_engine_different_filter_type: [ OK ] 0.64 sec.
2025-09-09 14:53:46 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.44 sec.
2025-09-09 14:53:47 02843_backup_use_same_password_for_base_backup: [ OK ] 9.59 sec.
2025-09-09 14:53:47 01499_json_named_tuples: [ OK ] 0.59 sec.
2025-09-09 14:53:47 01448_json_compact_strings_each_row: [ OK ] 1.44 sec.
2025-09-09 14:53:48 00966_invalid_json_must_not_parse: [ OK ] 0.69 sec.
2025-09-09 14:53:48 00606_quantiles_and_nans: [ OK ] 0.60 sec.
2025-09-09 14:53:48 03161_cnf_reduction: [ OK ] 0.83 sec.
2025-09-09 14:53:48 02345_create_table_allow_trailing_comma: [ OK ] 0.68 sec.
2025-09-09 14:53:49 03199_has_lc_fixed_string: [ OK ] 0.73 sec.
2025-09-09 14:53:49 02841_parallel_replicas_summary: [ OK ] 4.00 sec.
2025-09-09 14:53:49 02963_test_flexible_disk_configuration: [ OK ] 1.28 sec.
2025-09-09 14:53:49 03036_test_parquet_bloom_filter_push_down: [ OK ] 15.46 sec.
2025-09-09 14:53:49 02815_first_line: [ OK ] 0.64 sec.
2025-09-09 14:53:49 01700_point_in_polygon_ubsan: [ OK ] 0.38 sec.
2025-09-09 14:53:49 00534_functions_bad_arguments11: [ SKIPPED ] 0.00 sec.
2025-09-09 14:53:49 Reason: not running for current build
2025-09-09 14:53:49 01505_log_distributed_deadlock: [ OK ] 0.67 sec.
2025-09-09 14:53:50 01825_type_json_empty_string: [ OK ] 0.47 sec.
2025-09-09 14:53:50 02293_h3_line: [ OK ] 0.79 sec.
2025-09-09 14:53:51 01882_scalar_subquery_exception: [ OK ] 0.68 sec.
2025-09-09 14:53:51 02731_replace_partition_from_temporary_table: [ OK ] 1.64 sec.
2025-09-09 14:53:51 01244_optimize_distributed_group_by_sharding_key: [ OK ] 1.69 sec.
2025-09-09 14:53:51 00712_prewhere_with_alias: [ OK ] 0.98 sec.
2025-09-09 14:53:51 01062_pm_multiple_all_join_same_value: [ OK ] 0.58 sec.
2025-09-09 14:53:52 02353_partition_prune_nullable_key: [ OK ] 0.49 sec.
2025-09-09 14:53:52 00942_dataparts_500: [ OK ] 1.34 sec.
2025-09-09 14:53:52 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.89 sec.
2025-09-09 14:53:53 02381_arrow_dict_to_lc: [ OK ] 1.49 sec.
2025-09-09 14:53:53 03153_dynamic_type_empty: [ OK ] 0.74 sec.
2025-09-09 14:53:53 03251_unaligned_window_function_state: [ OK ] 0.63 sec.
2025-09-09 14:53:55 01943_query_id_check: [ OK ] 2.35 sec.
2025-09-09 14:53:55 02751_protobuf_ipv6: [ OK ] 1.69 sec.
2025-09-09 14:53:55 01312_case_insensitive_regexp: [ OK ] 0.69 sec.
2025-09-09 14:53:55 02871_clickhouse_client_restart_pager: [ OK ] 2.10 sec.
2025-09-09 14:53:56 03161_lightweight_delete_projection: [ OK ] 1.05 sec.
2025-09-09 14:53:56 03221_mutate_profile_events: [ OK ] 0.44 sec.
2025-09-09 14:53:57 02480_suspicious_lowcard_in_key: [ OK ] 0.59 sec.
2025-09-09 14:53:58 02136_scalar_read_rows_json: [ OK ] 2.56 sec.
2025-09-09 14:53:58 02183_dictionary_date_types: [ OK ] 1.03 sec.
2025-09-09 14:53:59 02461_cancel_finish_race: [ OK ] 30.58 sec.
2025-09-09 14:53:59 02245_s3_schema_desc: [ OK ] 0.45 sec.
2025-09-09 14:53:59 00685_output_format_json_escape_forward_slashes: [ OK ] 0.27 sec.
2025-09-09 14:53:59 02246_is_secure_query_log: [ OK ] 7.12 sec.
2025-09-09 14:53:59 02029_quantile_sanitizer: [ OK ] 0.32 sec.
2025-09-09 14:53:59 00337_shard_any_heavy: [ OK ] 0.32 sec.
2025-09-09 14:53:59 03157_dynamic_type_json: [ OK ] 0.37 sec.
2025-09-09 14:54:00 02883_read_in_reverse_order_virtual_column: [ OK ] 0.97 sec.
2025-09-09 14:54:00 00700_decimal_empty_aggregates: [ OK ] 0.67 sec.
2025-09-09 14:54:00 01274_generate_random_nested: [ OK ] 0.57 sec.
2025-09-09 14:54:00 02237_lzma_bug: [ OK ] 4.69 sec.
2025-09-09 14:54:00 02920_rename_column_of_skip_indices: [ OK ] 0.42 sec.
2025-09-09 14:54:01 02540_date_column_consistent_insert_behaviour: [ OK ] 0.77 sec.
2025-09-09 14:54:01 01508_query_obfuscator: [ OK ] 0.77 sec.
2025-09-09 14:54:01 01020_function_array_compact: [ OK ] 0.37 sec.
2025-09-09 14:54:01 02381_join_dup_columns_in_plan: [ OK ] 0.67 sec.
2025-09-09 14:54:01 02921_bit_hamming_distance_big_int: [ OK ] 0.42 sec.
2025-09-09 14:54:02 00318_pk_tuple_order: [ OK ] 0.67 sec.
2025-09-09 14:54:02 02907_fromDaysSinceYearZero: [ OK ] 0.67 sec.
2025-09-09 14:54:02 02688_aggregate_states: [ OK ] 0.62 sec.
2025-09-09 14:54:02 02265_column_ttl: [ OK ] 0.92 sec.
2025-09-09 14:54:02 01753_mutate_table_predicated_with_table: [ OK ] 0.42 sec.
2025-09-09 14:54:02 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.37 sec.
2025-09-09 14:54:03 01016_macros: [ OK ] 0.32 sec.
2025-09-09 14:54:03 02875_final_invalid_read_ranges_bug: [ OK ] 0.53 sec.
2025-09-09 14:54:03 03246_json_simd_rapid_parsers: [ OK ] 1.22 sec.
2025-09-09 14:54:03 01702_toDateTime_from_string_clamping: [ OK ] 0.37 sec.
2025-09-09 14:54:03 02356_insert_query_log_metrics: [ OK ] 0.57 sec.
2025-09-09 14:54:03 03155_datasketches_ubsan: [ OK ] 0.32 sec.
2025-09-09 14:54:03 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.42 sec.
2025-09-09 14:54:03 00752_low_cardinality_permute: [ OK ] 0.37 sec.
2025-09-09 14:54:04 03276_functions_to_subcolumns_lc: [ OK ] 0.37 sec.
2025-09-09 14:54:04 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.32 sec.
2025-09-09 14:54:04 03003_compatibility_setting_bad_value: [ OK ] 0.32 sec.
2025-09-09 14:54:04 02097_polygon_dictionary_store_key: [ OK ] 0.37 sec.
2025-09-09 14:54:04 01385_not_function: [ OK ] 0.32 sec.
2025-09-09 14:54:04 02006_test_positional_arguments_on_cluster: [ OK ] 0.72 sec.
2025-09-09 14:54:04 01925_json_as_string_data_in_square_brackets: [ OK ] 0.37 sec.
2025-09-09 14:54:05 01731_async_task_queue_wait: [ OK ] 2.98 sec.
2025-09-09 14:54:05 02112_delayed_clickhouse_local: [ OK ] 0.77 sec.
2025-09-09 14:54:05 01498_alter_column_storage_memory: [ OK ] 0.38 sec.
2025-09-09 14:54:05 00506_union_distributed: [ OK ] 0.57 sec.
2025-09-09 14:54:05 01767_timezoneOf: [ OK ] 0.77 sec.
2025-09-09 14:54:05 00098_a_union_all: [ OK ] 0.32 sec.
2025-09-09 14:54:05 02354_numeric_literals_with_underscores: [ OK ] 0.37 sec.
2025-09-09 14:54:06 01097_one_more_range_reader_test_wide_part: [ OK ] 0.47 sec.
2025-09-09 14:54:06 01515_logtrace_function: [ OK ] 0.97 sec.
2025-09-09 14:54:06 00956_http_prepared_statements: [ OK ] 0.77 sec.
2025-09-09 14:54:06 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.42 sec.
2025-09-09 14:54:07 01214_test_storage_merge_aliases_with_where: [ OK ] 0.52 sec.
2025-09-09 14:54:07 02293_ttest_large_samples: [ OK ] 1.77 sec.
2025-09-09 14:54:07 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.67 sec.
2025-09-09 14:54:07 01322_cast_keep_nullable: [ OK ] 0.47 sec.
2025-09-09 14:54:07 02176_dict_get_has_implicit_key_cast: [ OK ] 0.67 sec.
2025-09-09 14:54:08 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.32 sec.
2025-09-09 14:54:08 01424_parse_date_time_bad_date: [ OK ] 0.37 sec.
2025-09-09 14:54:08 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec.
2025-09-09 14:54:08 Reason: not running for current build
2025-09-09 14:54:09 02011_tuple_vector_functions: [ OK ] 1.07 sec.
2025-09-09 14:54:09 01822_short_circuit: [ OK ] 1.22 sec.
2025-09-09 14:54:09 02260_alter_compact_part_drop_nested_column: [ OK ] 0.52 sec.
2025-09-09 14:54:09 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 23.42 sec.
2025-09-09 14:54:09 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.32 sec.
2025-09-09 14:54:09 00534_functions_bad_arguments12: [ SKIPPED ] 0.00 sec.
2025-09-09 14:54:09 Reason: not running for current build
2025-09-09 14:54:10 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.37 sec.
2025-09-09 14:54:10 02968_url_args: [ OK ] 0.37 sec.
2025-09-09 14:54:10 01798_having_push_down: [ OK ] 0.42 sec.
2025-09-09 14:54:10 00700_to_decimal_or_something_1: [ OK ] 1.07 sec.
2025-09-09 14:54:10 00097_long_storage_buffer_race_condition: [ OK ] 12.06 sec.
2025-09-09 14:54:10 02158_proportions_ztest: [ OK ] 0.37 sec.
2025-09-09 14:54:10 02898_parallel_replicas_custom_key_final: [ OK ] 0.37 sec.
2025-09-09 14:54:11 01604_explain_ast_of_nonselect_query: [ OK ] 0.37 sec.
2025-09-09 14:54:11 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.32 sec.
2025-09-09 14:54:11 01268_mv_scalars: [ OK ] 0.52 sec.
2025-09-09 14:54:11
2025-09-09 14:54:11 Having 1 errors! 440 tests passed. 7 tests skipped. 634.82 s elapsed (Process-7).
2025-09-09 14:54:11 02810_row_binary_with_defaults: [ OK ] 0.37 sec.
2025-09-09 14:54:11
2025-09-09 14:54:11 402 tests passed. 4 tests skipped. 634.90 s elapsed (Process-5).
2025-09-09 14:54:11 01710_projections_order_by_complete: [ OK ] 0.42 sec.
2025-09-09 14:54:11
2025-09-09 14:54:11 369 tests passed. 5 tests skipped. 635.01 s elapsed (Process-8).
2025-09-09 14:54:11 00734_timeslot: [ OK ] 0.42 sec.
2025-09-09 14:54:11
2025-09-09 14:54:11 Having 1 errors! 406 tests passed. 8 tests skipped. 635.04 s elapsed (Process-6).
2025-09-09 14:54:15 02421_truncate_isolation_with_mutations: [ OK ] 26.20 sec.
2025-09-09 14:54:15
2025-09-09 14:54:15 408 tests passed. 4 tests skipped. 639.23 s elapsed (Process-10).
2025-09-09 14:54:18 00652_replicated_mutations_zookeeper: [ OK ] 11.55 sec.
2025-09-09 14:54:18
2025-09-09 14:54:18 413 tests passed. 5 tests skipped. 641.79 s elapsed (Process-3).
2025-09-09 14:54:28 02030_rocksdb_race_long: [ OK ] 21.27 sec.
2025-09-09 14:54:28
2025-09-09 14:54:28 431 tests passed. 2 tests skipped. 652.21 s elapsed (Process-9).
2025-09-09 14:54:35 01171_mv_select_insert_isolation_long: [ OK ] 131.61 sec.
2025-09-09 14:54:35
2025-09-09 14:54:35 339 tests passed. 6 tests skipped. 659.33 s elapsed (Process-4).
2025-09-09 14:54:42 Running 281 stateless tests (MainProcess).
2025-09-09 14:54:46 03231_restore_user_with_existing_role: [ OK ] 3.88 sec.
2025-09-09 14:54:51 03206_replication_lag_metric: [ OK ] 5.38 sec.
2025-09-09 14:54:52 03198_table_function_directory_path: [ OK ] 0.42 sec.
2025-09-09 14:54:52 03198_dynamic_read_subcolumns: [ OK ] 0.42 sec.
2025-09-09 14:54:53 03168_loop_engine_with_parallel_replicas: [ OK ] 0.32 sec.
2025-09-09 14:54:54 03154_lazy_token_iterator: [ OK ] 1.67 sec.
2025-09-09 14:55:11 03151_unload_index_race: [ OK ] 16.96 sec.
2025-09-09 14:55:11 03147_system_columns_access_checks: [ SKIPPED ] 0.00 sec.
2025-09-09 14:55:11 Reason: not running for current build
2025-09-09 14:55:12 03147_parquet_memory_tracking: [ OK ] 0.72 sec.
2025-09-09 14:55:12 03147_table_function_loop: [ OK ] 0.37 sec.
2025-09-09 14:56:00 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 47.49 sec.
2025-09-09 14:56:04 03008_s3_plain_rewritable_fault: [ OK ] 4.18 sec.
2025-09-09 14:56:43 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 39.37 sec.
2025-09-09 14:57:21 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 37.67 sec.
2025-09-09 14:58:08 03008_deduplication_insert_several_blocks_replicated: [ OK ] 47.24 sec.
2025-09-09 14:58:10 03002_part_log_rmt_fetch_merge_error: [ OK ] 2.12 sec.
2025-09-09 14:58:16 03002_part_log_rmt_fetch_mutate_error: [ OK ] 5.98 sec.
2025-09-09 14:58:17 02990_rmt_replica_path_uuid: [ OK ] 0.42 sec.
2025-09-09 14:58:19 02980_dist_insert_readonly_replica: [ OK ] 2.02 sec.
2025-09-09 14:58:21 02973_backup_of_in_memory_compressed: [ OK ] 2.32 sec.
2025-09-09 14:59:07 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 45.84 sec.
2025-09-09 14:59:08 02961_drop_tables: [ OK ] 0.47 sec.
2025-09-09 14:59:08 02960_partition_by_udf: [ OK ] 0.37 sec.
2025-09-09 14:59:11 02944_dynamically_change_filesystem_cache_size: [ OK ] 3.38 sec.
2025-09-09 14:59:15 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 3.93 sec.
2025-09-09 14:59:16 02931_max_num_to_warn: [ OK ] 0.52 sec.
2025-09-09 14:59:20 02916_move_partition_inactive_replica: [ OK ] 3.78 sec.
2025-09-09 14:59:23 02915_move_partition_inactive_replica: [ OK ] 2.88 sec.
2025-09-09 14:59:23 02911_row_policy_on_cluster: [ OK ] 0.67 sec.
2025-09-09 14:59:24 02910_prefetch_unexpceted_exception: [ OK ] 0.17 sec.
2025-09-09 14:59:24 02908_empty_named_collection: [ OK ] 0.32 sec.
2025-09-09 14:59:28 02908_many_requests_to_system_replicas: [ OK ] 3.33 sec.
2025-09-09 14:59:31 02888_replicated_merge_tree_creation: [ OK ] 3.68 sec.
2025-09-09 14:59:32 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.47 sec.
2025-09-09 14:59:32 02884_async_insert_skip_settings: [ OK ] 0.62 sec.
2025-09-09 14:59:35 02884_async_insert_native_protocol_3: [ OK ] 2.42 sec.
2025-09-09 14:59:44 02874_parquet_multiple_batches_array_inconsistent_offsets: [ OK ] 8.74 sec.
2025-09-09 14:59:53 02871_peak_threads_usage: [ OK ] 9.74 sec.
2025-09-09 14:59:54 02867_create_user_ssh: [ OK ] 0.27 sec.
2025-09-09 14:59:54 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.42 sec.
2025-09-09 14:59:56 02845_threads_count_in_distributed_queries: [ OK ] 1.82 sec.
2025-09-09 14:59:57 02843_insertion_table_schema_infer: [ OK ] 0.67 sec.
2025-09-09 14:59:59 02841_parquet_filter_pushdown: [ OK ] 2.67 sec.
2025-09-09 15:00:00 02833_multiprewhere_extra_column: [ OK ] 0.37 sec.
2025-09-09 15:00:02 02808_filesystem_cache_drop_query: [ OK ] 2.37 sec.
2025-09-09 15:00:03 02796_calculate_text_stack_trace: [ OK ] 1.27 sec.
2025-09-09 15:00:06 02789_filesystem_cache_alignment: [ OK ] 2.88 sec.
2025-09-09 15:00:08 02789_table_functions_errors: [ OK ] 1.42 sec.
2025-09-09 15:00:08 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec.
2025-09-09 15:00:08 Reason: not running for current build
2025-09-09 15:00:08 02775_show_columns_called_from_mysql: [ OK ] 0.77 sec.
2025-09-09 15:00:09 02762_replicated_database_no_args: [ OK ] 0.32 sec.
2025-09-09 15:00:10 02751_ip_types_aggregate_functions_states: [ OK ] 0.77 sec.
2025-09-09 15:00:11 02736_reading_and_writing_structure_fields: [ OK ] 1.32 sec.
2025-09-09 15:00:12 02735_capnp_case_insensitive_names_matching: [ OK ] 0.67 sec.
2025-09-09 15:00:17 02735_parquet_encoder: [ OK ] 5.53 sec.
2025-09-09 15:00:18 02725_url_support_virtual_column: [ OK ] 0.37 sec.
2025-09-09 15:00:44 02725_start_stop_fetches: [ OK ] 26.24 sec.
2025-09-09 15:00:44 02710_default_replicated_parameters: [ OK ] 0.32 sec.
2025-09-09 15:00:45 02706_show_columns: [ OK ] 0.67 sec.
2025-09-09 15:00:59 02700_s3_part_INT_MAX: [ OK ] 14.21 sec.
2025-09-09 15:00:59 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec.
2025-09-09 15:00:59 Reason: not running for current build
2025-09-09 15:01:00 02572_system_logs_materialized_views_ignore_errors: [ OK ] 0.77 sec.
2025-09-09 15:01:02 02566_ipv4_ipv6_binary_formats: [ OK ] 2.57 sec.
2025-09-09 15:01:03 02561_temporary_table_sessions: [ OK ] 0.72 sec.
2025-09-09 15:01:04 02541_arrow_duration_type: [ OK ] 0.82 sec.
2025-09-09 15:01:21 02535_max_parallel_replicas_custom_key_mt: [ OK ] 16.76 sec.
2025-09-09 15:01:37 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 16.51 sec.
2025-09-09 15:01:38 02522_avro_complicate_schema: [ OK ] 0.82 sec.
2025-09-09 15:02:09 02515_cleanup_async_insert_block_ids: [ OK ] 31.05 sec.
2025-09-09 15:02:10 02510_orc_map_indexes: [ OK ] 0.72 sec.
2025-09-09 15:02:11 02503_cache_on_write_with_small_segment_size: [ OK ] 1.42 sec.
2025-09-09 15:02:14 02503_insert_storage_snapshot: [ OK ] 3.03 sec.
2025-09-09 15:02:15 02501_deep_recusion_schema_inference: [ OK ] 0.92 sec.
2025-09-09 15:02:15 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec.
2025-09-09 15:02:15 Reason: not running for current build
2025-09-09 15:02:16 02495_s3_filter_by_file: [ OK ] 0.47 sec.
2025-09-09 15:02:16 02494_query_cache_user_quotas_after_drop: [ OK ] 0.37 sec.
2025-09-09 15:02:17 02494_query_cache_query_log: [ OK ] 0.72 sec.
2025-09-09 15:02:17 02494_query_cache_case_agnostic_matching: [ OK ] 0.37 sec.
2025-09-09 15:02:18 02494_query_cache_compression: [ OK ] 0.37 sec.
2025-09-09 15:02:18 02494_query_cache_totals_extremes: [ OK ] 0.57 sec.
2025-09-09 15:02:19 02494_query_cache_exception_handling: [ OK ] 0.32 sec.
2025-09-09 15:02:19 02494_query_cache_eligible_queries: [ OK ] 0.42 sec.
2025-09-09 15:02:25 02494_query_cache_ttl_long: [ OK ] 6.38 sec.
2025-09-09 15:02:26 02494_query_cache_events: [ OK ] 0.62 sec.
2025-09-09 15:02:29 02494_trace_log_profile_events: [ OK ] 2.68 sec.
2025-09-09 15:02:29 02494_query_cache_bugs: [ OK ] 0.37 sec.
2025-09-09 15:02:30 02494_query_cache_squash_partial_results: [ OK ] 0.47 sec.
2025-09-09 15:02:30 02484_substitute_udf_storage_args: [ OK ] 0.32 sec.
2025-09-09 15:02:30 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.37 sec.
2025-09-09 15:02:32 02483_capnp_decimals: [ OK ] 1.37 sec.
2025-09-09 15:02:32 02482_new_json_nested_arrays_with_same_keys: [ OK ] 0.67 sec.
2025-09-09 15:02:33 02482_json_nested_arrays_with_same_keys: [ OK ] 0.72 sec.
2025-09-09 15:02:34 02481_custom_separated_and_template_with_csv_field: [ OK ] 1.12 sec.
2025-09-09 15:02:36 02459_glob_for_recursive_directory_traversal: [ OK ] 1.72 sec.
2025-09-09 15:02:36 02458_hdfs_cluster_schema_inference: [ OK ] 0.42 sec.
2025-09-09 15:02:40 02440_mutations_finalization: [ OK ] 3.38 sec.
2025-09-09 15:02:40 02422_msgpack_uuid_wrong_column: [ OK ] 0.37 sec.
2025-09-09 15:02:42 02422_allow_implicit_no_password: [ OK ] 2.02 sec.
2025-09-09 15:02:49 02421_record_errors_row_by_input_format: [ OK ] 6.53 sec.
2025-09-09 15:02:49 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.37 sec.
2025-09-09 15:02:50 02404_schema_inference_cache_respect_format_settings: [ OK ] 0.67 sec.
2025-09-09 15:02:50 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec.
2025-09-09 15:02:50 Reason: disabled
2025-09-09 15:02:50 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec.
2025-09-09 15:02:50 Reason: disabled
2025-09-09 15:02:50 02391_recursive_buffer: [ OK ] 0.42 sec.
2025-09-09 15:02:51 02385_profile_events_overflow: [ OK ] 0.47 sec.
2025-09-09 15:02:51 02376_arrow_dict_with_string: [ OK ] 0.32 sec.
2025-09-09 15:02:52 02373_heap_buffer_overflow_in_avro: [ OK ] 0.87 sec.
2025-09-09 15:02:52 02352_rwlock: [ SKIPPED ] 0.00 sec.
2025-09-09 15:02:52 Reason: not running for current build
2025-09-09 15:02:53 02350_views_max_insert_threads: [ OK ] 0.67 sec.
2025-09-09 15:02:53 02346_additional_filters_distr: [ OK ] 0.37 sec.
2025-09-09 15:02:55 02337_drop_filesystem_cache_access: [ OK ] 1.62 sec.
2025-09-09 15:02:55 02323_null_modifier_in_table_function: [ OK ] 0.32 sec.
2025-09-09 15:02:56 02313_avro_records_and_maps: [ OK ] 0.42 sec.
2025-09-09 15:02:57 02311_system_zookeeper_insert_priv: [ OK ] 0.92 sec.
2025-09-09 15:02:57 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.32 sec.
2025-09-09 15:03:09 02294_overcommit_overflow: [ OK ] 11.65 sec.
2025-09-09 15:03:34 02286_mysql_dump_input_format: [ OK ] 25.14 sec.
2025-09-09 15:03:36 02262_column_ttl: [ OK ] 2.02 sec.
2025-09-09 15:03:44 02247_written_bytes_quota: [ OK ] 7.89 sec.
2025-09-09 15:03:44 02244_lowcardinality_hash_join: [ OK ] 0.42 sec.
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/xwbbawisvezkicgawbfdyvoxmizjneoc HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/mjtoxktfmpxhgmvlfkkkzpbbbugqwvxp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/yhmyqsyqrjocawkxjpknvhyyznwcsrrd HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/lflmxmcyxsmjhzxjpvryhdmjvynlbsfl HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/drvdztarsbywkloydsgjlfahdjngpbkk HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/qotsjzjogdijwjyueilodmgpgcnvdgxq HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/vhmdkawdzwblayjehwzlybtsyijpeodj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/hszezxwiyvzmfsldwkpluxuxhclwcras HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/zcinkobzfsfmfvayfbrjmsohzaiojehr HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "PUT /devstoreaccount1/cont/norzzzntjyxtmwgeeusfcjowxetdmjgs HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "GET /devstoreaccount1/cont/yhmyqsyqrjocawkxjpknvhyyznwcsrrd HTTP/1.1" 206 520
127.0.0.1 - - [09/Sep/2025:13:03:48 +0000] "GET /devstoreaccount1/cont/mjtoxktfmpxhgmvlfkkkzpbbbugqwvxp HTTP/1.1" 206 808111
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/norzzzntjyxtmwgeeusfcjowxetdmjgs HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/vhmdkawdzwblayjehwzlybtsyijpeodj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/drvdztarsbywkloydsgjlfahdjngpbkk HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/mjtoxktfmpxhgmvlfkkkzpbbbugqwvxp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/yhmyqsyqrjocawkxjpknvhyyznwcsrrd HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/lflmxmcyxsmjhzxjpvryhdmjvynlbsfl HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/qotsjzjogdijwjyueilodmgpgcnvdgxq HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/zcinkobzfsfmfvayfbrjmsohzaiojehr HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/hszezxwiyvzmfsldwkpluxuxhclwcras HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:03:49 +0000] "DELETE /devstoreaccount1/cont/xwbbawisvezkicgawbfdyvoxmizjneoc HTTP/1.1" 202 -
2025-09-09 15:03:49 02242_system_filesystem_cache_log_table: [ OK ] 5.08 sec.
2025-09-09 15:04:01 02242_delete_user_race: [ OK ] 11.35 sec.
127.0.0.1 - - [09/Sep/2025:13:04:11 +0000] "PUT /devstoreaccount1/cont/hjddrqumqlxofdreatqwpynpziqiputf HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/yyfzlmhknklaebbrxlzrurcabcjmstju HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/zcopzxdwpvihwibaaiwzknhhvrffpvdz HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/pdjchjpeelspwbgmcfrcydobtdjhsakj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/ldfzfcnsozkawnifwvdrkrjluaintkoo HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/insgfsnzmjewnaenexjqddodeddkpnxq HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/errjccokflvuydfrsvuujlsuehzyheky HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/evazouytkrmlsycppuskbxleenjgynib HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:12 +0000] "PUT /devstoreaccount1/cont/bftdbhtfvxuxorlsvbgrtdyqzhiidpcp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/jnebrpxrrobmpdoaeucftdiolzvxbrng HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/wcwkoencakqhqrcuntdveblscwojomvf HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/xulzkwqqandlkegolupgbkmdtzqrcuaj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/ohtwmtxdyirbktrczdnizvughxskgjvy HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/yrsadosyrkrvhvojjpfkeblfzbiuatxf HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/notaotdiaokcadufznljznbuwhzqgwjg HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/xlhnsipsiljyxigdswuczddtrerxvrpy HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:13 +0000] "PUT /devstoreaccount1/cont/cipjirimymrbsmtkbvvqtljzwxjzegft HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/ptqzkpimuyqtubfapjmzwubkshdjzfam HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/kuafqsokdifhwteweznejpuokbzmjmuv HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/sllzjbhmmzwludurplbkrhgopsijvyac HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/cvvomfekfqgjucfeluwqfvqupwqbjkor HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/unzrdgbhuedjciizvaresqtflxiyeooi HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/qvpwobwwrxifodugotartoyogipiouha HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/rjcymdmnfqnjufoyzlcpyrpobeyfsvml HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/joqcqzolcmmtygvdsefhqdrrkonayzvb HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/ydwlgaibogsmxoyikbuitsmvafzqdiwk HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/qlrtffebspbvjgjkmjgottafcrpzrqwc HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/fwpmwtjivkluyglrnpljcdhsernwutmt HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/wydovcawphepnwvnjoknsbzaupyxzxnl HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/cfkckygfpghcobcmnfhiyeoytemzwney HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/srphszkdueaonzrasndkcklwdlnfdzqn HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/ltcjykxozunuofmaakjadhvwvjgrorox HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:14 +0000] "PUT /devstoreaccount1/cont/gvhhpzhukslefxbyoeudvdnmidfdjfug HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/coibwfjgagxwemlllnduuuqlytxlwhuv HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/qrvkrxcmguteddlxejgovzbbokpymcwg HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/lcxxytwnuvsoydnynfkebdbjqnfxcqlx HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/gyfzgtfbbdsopnckidgtaezoorxaqrwe HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/zmxsydgsthgdhuwbmpypqcksxbjjayqm HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/xtnnvocrdaidxezdakrtqvlxjhjmvnmd HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/szrlyvgpybjenoxqeddrnmnqwswwcavu HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/ejtbolzbuoahvzrmhwtitnkernntmoiw HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "GET /devstoreaccount1/cont/kuafqsokdifhwteweznejpuokbzmjmuv HTTP/1.1" 206 80
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "GET /devstoreaccount1/cont/yyfzlmhknklaebbrxlzrurcabcjmstju HTTP/1.1" 206 746
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "GET /devstoreaccount1/cont/ptqzkpimuyqtubfapjmzwubkshdjzfam HTTP/1.1" 206 746
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/rwvzwztqyvhircrzxkfrnlsetqhmvsug HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/rpcduzsqhlcpmzxpitgcienhxqpwpcjn HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/rvfdimldghztgosabojmdqzyntnersac HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/hytbqcrrwirrjnhrlvlqbrryrdesvslu HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/fvvhxxyhapbwiezeaveccfvrzttwfwnk HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/wptruncelazgswdupgkilpdfrsmxzpmz HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/fegrdynviavrjtqlogeebgfmgcbxotli HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/gwbxmvzvppylkretgfkhctgswbnafmhl HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/dvhxwdnyzoeiwlrefotdklxyglcudmbx HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/jlqrjrjpivkfzxkwqoqqrinafiqeukyi HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/qsutfdpywklciuperonpbuytxwcxaeud HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/apfimltjbrwaaqsrzrxejowmkwykmhvh HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/znuzoxbqtiivwmdwyhbfsumxepvasavj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/yggutwaomrdrjxrxlcxtxyhwfiqsltwv HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/mzncbprughvpskqsctydvftbskvpajvw HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/pkqwirqylkzcrjpipjruaeogcsfwaifm HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/rnhmbvofjrgdsyqeivvriitcdkydwocn HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/jqgynmuwkqwzstwpjinisdbfpmydhmov HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/gyarnktcqvaedpznsbranvvkotbizfam HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/xfvwiiqckrbphtiggaqurdxnjqxrsswx HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/xhlzkmyjegzglhlecmkzjkxhpzqjjsvr HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/rdzoewcguxpfbcvunvekxkisurichfku HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/vxaeamvzxwipvdicjvrvcjjfctgistbp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/elsiqrmlzpjzyjhsxhfavyufrnhjjvyw HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/scdmbycjdxdclercudxtbkimbrslaspb HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/xjyendjbyuczscpxvjpvqpipecdfdmga HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:15 +0000] "PUT /devstoreaccount1/cont/zvssuxcorriuoovuhmrnwjqcgulrplzd HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/hldujpmjksdpauctstdpxyxcjztihwoi HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/wxxbfbbujlcpgwdvmuljbzjrseyarowr HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/hmuqgkuklfrmabhfqqsaawxikvcdugba HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/ropprjzwsishuelhouehgekedwqsexyg HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/pjxkjvdcicrpxzxdqvfyxmsjoomqaklc HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/qjdedmcjqujamokymgxsngejdcxdjocf HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/moywflqmvhviigortomjoiayvuueklsi HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/kfvgtuwjlbwwjwmdvecqdijgbinbkvhv HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/jbfweijbpbeutlqrmhqrxmjnxkcqrmos HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/wicoyvkfdioffxpxxojlcbgaetmedgpb HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/mmyartftjohdfvttjcdsumdblukkkpfg HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/ayjycoutpzkpawvghnpkgggkdwvxuuxg HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/jtcjhluxlmftiywpzqbnhfszxwhoxhta HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/pwaxkualkaazteqhgzlihddhwehtymfw HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/rserhfsquajwwegmabwjsilpmdcsiixn HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/xazepljnzkwlpaezqxqycczskysjlobe HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/ingejtblcmwlultycsobfkgvqytypdgm HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/mvwixjhzmownkhlqnudjmoglrbldkfwm HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/wsabkuyoyftgibylhosmjykkbabehwlz HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/mhemavezbhvzvclpgsspztftfbmkeobx HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/wrprxllufbxlijfzzhgedbxrpxatulst HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/tkaczmorzlvsyexthwswtjsdxhiurpbi HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/sfewhnvfypxgohucswyqqislcxuybgtj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/igqvpapndpfypuqtdetrfhcqzudajrna HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/qyoexltuhzhbheazvbtvrzjaaaiuytdp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/xoylanhxykpbxnkcvhusdpagtlglchye HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/nzicavqfwurzuahvnmsavlsczeegcqau HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/zfjzvipjzbocdfldwwopljkpffiamhmv HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/khjvtksnlichxsbwxqyodrbqdgnlsumo HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/xhqaqwsttyxmunkaxpthpirlpsxyxfsm HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/hasavddlfqmlywjvujqpvzvdogyhzsjo HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/lpgnqwypeemfneiqiqhcvifmnsvtcgub HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/oohzcfvpmhfdzustnvbceyxdykquizky HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/bebtnntkxbvqltcfnjlsuzhnbslksoce HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/zarnujglwkzrvieynfrsqotylvpkrobd HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/hjhrxadiglbkowesrmnbfdifttikldwn HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/wsytkfkfyrbnpkyymvbkovomgyyhkkfp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/zydvttprgkxpnlnyfcqrebmjwbxscqpl HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/jtyyqsixvpbgwomispicoqqyoxjfwmfs HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:16 +0000] "PUT /devstoreaccount1/cont/wpvzutyctypjyletwkxbhierqqombkfi HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/vepbpxzpihozugqhgdsasvkxzfbjpopf HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/qlxxskacwturlnwaharfftqumlyxvxal HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/fnulhxczccalqbtgfmvlbawepbbiyywu HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/xyiybadzisnlirurbwsxrjrckzsuunhu HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/oyrnrpstvhidsfifqoczmpvloppubrmc HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/efvsekxctrwvknfqaoceddfhbxdqpopp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/dtinxgbqsphxdwvagjldmrfbknspgywa HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/zxrszcosliplewzszffgbnojrjvcywea HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/ohrawwnukegomicqbpmfpzsbvrvwtuab HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "PUT /devstoreaccount1/cont/ylwtikykfpkecyyxmitidbqtrojallvk HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ylwtikykfpkecyyxmitidbqtrojallvk HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/vepbpxzpihozugqhgdsasvkxzfbjpopf HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/efvsekxctrwvknfqaoceddfhbxdqpopp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/qlxxskacwturlnwaharfftqumlyxvxal HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/dtinxgbqsphxdwvagjldmrfbknspgywa HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/oyrnrpstvhidsfifqoczmpvloppubrmc HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/fnulhxczccalqbtgfmvlbawepbbiyywu HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xyiybadzisnlirurbwsxrjrckzsuunhu HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ohrawwnukegomicqbpmfpzsbvrvwtuab HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/zxrszcosliplewzszffgbnojrjvcywea HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/bftdbhtfvxuxorlsvbgrtdyqzhiidpcp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/insgfsnzmjewnaenexjqddodeddkpnxq HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ldfzfcnsozkawnifwvdrkrjluaintkoo HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/yyfzlmhknklaebbrxlzrurcabcjmstju HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/zcopzxdwpvihwibaaiwzknhhvrffpvdz HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/pdjchjpeelspwbgmcfrcydobtdjhsakj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/evazouytkrmlsycppuskbxleenjgynib HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/errjccokflvuydfrsvuujlsuehzyheky HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/gwbxmvzvppylkretgfkhctgswbnafmhl HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/fvvhxxyhapbwiezeaveccfvrzttwfwnk HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/hytbqcrrwirrjnhrlvlqbrryrdesvslu HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/rwvzwztqyvhircrzxkfrnlsetqhmvsug HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/rpcduzsqhlcpmzxpitgcienhxqpwpcjn HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/rvfdimldghztgosabojmdqzyntnersac HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/fegrdynviavrjtqlogeebgfmgcbxotli HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wptruncelazgswdupgkilpdfrsmxzpmz HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/rnhmbvofjrgdsyqeivvriitcdkydwocn HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/yggutwaomrdrjxrxlcxtxyhwfiqsltwv HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/znuzoxbqtiivwmdwyhbfsumxepvasavj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/jlqrjrjpivkfzxkwqoqqrinafiqeukyi HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/qsutfdpywklciuperonpbuytxwcxaeud HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/apfimltjbrwaaqsrzrxejowmkwykmhvh HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/pkqwirqylkzcrjpipjruaeogcsfwaifm HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/mzncbprughvpskqsctydvftbskvpajvw HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/cipjirimymrbsmtkbvvqtljzwxjzegft HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/yrsadosyrkrvhvojjpfkeblfzbiuatxf HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ohtwmtxdyirbktrczdnizvughxskgjvy HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/jnebrpxrrobmpdoaeucftdiolzvxbrng HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wcwkoencakqhqrcuntdveblscwojomvf HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xulzkwqqandlkegolupgbkmdtzqrcuaj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xlhnsipsiljyxigdswuczddtrerxvrpy HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/notaotdiaokcadufznljznbuwhzqgwjg HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/joqcqzolcmmtygvdsefhqdrrkonayzvb HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/unzrdgbhuedjciizvaresqtflxiyeooi HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/cvvomfekfqgjucfeluwqfvqupwqbjkor HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ptqzkpimuyqtubfapjmzwubkshdjzfam HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/kuafqsokdifhwteweznejpuokbzmjmuv HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/sllzjbhmmzwludurplbkrhgopsijvyac HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/rjcymdmnfqnjufoyzlcpyrpobeyfsvml HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/qvpwobwwrxifodugotartoyogipiouha HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/gvhhpzhukslefxbyoeudvdnmidfdjfug HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/cfkckygfpghcobcmnfhiyeoytemzwney HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wydovcawphepnwvnjoknsbzaupyxzxnl HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ydwlgaibogsmxoyikbuitsmvafzqdiwk HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/qlrtffebspbvjgjkmjgottafcrpzrqwc HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/fwpmwtjivkluyglrnpljcdhsernwutmt HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ltcjykxozunuofmaakjadhvwvjgrorox HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/srphszkdueaonzrasndkcklwdlnfdzqn HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ejtbolzbuoahvzrmhwtitnkernntmoiw HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/zmxsydgsthgdhuwbmpypqcksxbjjayqm HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/gyfzgtfbbdsopnckidgtaezoorxaqrwe HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/coibwfjgagxwemlllnduuuqlytxlwhuv HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/qrvkrxcmguteddlxejgovzbbokpymcwg HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/lcxxytwnuvsoydnynfkebdbjqnfxcqlx HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/szrlyvgpybjenoxqeddrnmnqwswwcavu HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xtnnvocrdaidxezdakrtqvlxjhjmvnmd HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/zvssuxcorriuoovuhmrnwjqcgulrplzd HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/jqgynmuwkqwzstwpjinisdbfpmydhmov HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/vxaeamvzxwipvdicjvrvcjjfctgistbp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/gyarnktcqvaedpznsbranvvkotbizfam HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/elsiqrmlzpjzyjhsxhfavyufrnhjjvyw HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/rdzoewcguxpfbcvunvekxkisurichfku HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xfvwiiqckrbphtiggaqurdxnjqxrsswx HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xhlzkmyjegzglhlecmkzjkxhpzqjjsvr HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xjyendjbyuczscpxvjpvqpipecdfdmga HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/scdmbycjdxdclercudxtbkimbrslaspb HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wicoyvkfdioffxpxxojlcbgaetmedgpb HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/hldujpmjksdpauctstdpxyxcjztihwoi HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/qjdedmcjqujamokymgxsngejdcxdjocf HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wxxbfbbujlcpgwdvmuljbzjrseyarowr HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/moywflqmvhviigortomjoiayvuueklsi HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/pjxkjvdcicrpxzxdqvfyxmsjoomqaklc HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/hmuqgkuklfrmabhfqqsaawxikvcdugba HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ropprjzwsishuelhouehgekedwqsexyg HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/jbfweijbpbeutlqrmhqrxmjnxkcqrmos HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/kfvgtuwjlbwwjwmdvecqdijgbinbkvhv HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/mhemavezbhvzvclpgsspztftfbmkeobx HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/mmyartftjohdfvttjcdsumdblukkkpfg HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xazepljnzkwlpaezqxqycczskysjlobe HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ayjycoutpzkpawvghnpkgggkdwvxuuxg HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/ingejtblcmwlultycsobfkgvqytypdgm HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/rserhfsquajwwegmabwjsilpmdcsiixn HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/jtcjhluxlmftiywpzqbnhfszxwhoxhta HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/pwaxkualkaazteqhgzlihddhwehtymfw HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wsabkuyoyftgibylhosmjykkbabehwlz HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/mvwixjhzmownkhlqnudjmoglrbldkfwm HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xhqaqwsttyxmunkaxpthpirlpsxyxfsm HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wrprxllufbxlijfzzhgedbxrpxatulst HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/xoylanhxykpbxnkcvhusdpagtlglchye HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/tkaczmorzlvsyexthwswtjsdxhiurpbi HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/nzicavqfwurzuahvnmsavlsczeegcqau HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/qyoexltuhzhbheazvbtvrzjaaaiuytdp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/sfewhnvfypxgohucswyqqislcxuybgtj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/igqvpapndpfypuqtdetrfhcqzudajrna HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/khjvtksnlichxsbwxqyodrbqdgnlsumo HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/zfjzvipjzbocdfldwwopljkpffiamhmv HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wpvzutyctypjyletwkxbhierqqombkfi HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/hasavddlfqmlywjvujqpvzvdogyhzsjo HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/hjhrxadiglbkowesrmnbfdifttikldwn HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/lpgnqwypeemfneiqiqhcvifmnsvtcgub HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/wsytkfkfyrbnpkyymvbkovomgyyhkkfp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/zarnujglwkzrvieynfrsqotylvpkrobd HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/oohzcfvpmhfdzustnvbceyxdykquizky HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/bebtnntkxbvqltcfnjlsuzhnbslksoce HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/jtyyqsixvpbgwomispicoqqyoxjfwmfs HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/zydvttprgkxpnlnyfcqrebmjwbxscqpl HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/hjddrqumqlxofdreatqwpynpziqiputf HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:17 +0000] "DELETE /devstoreaccount1/cont/dvhxwdnyzoeiwlrefotdklxyglcudmbx HTTP/1.1" 202 -
2025-09-09 15:04:17 02241_filesystem_cache_on_write_operations: [ OK ] 16.46 sec.
2025-09-09 15:04:18 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.27 sec.
2025-09-09 15:04:18 02240_filesystem_query_cache: [ OK ] 0.27 sec.
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/vlpewwbpywjpicelxshxyofgjzrrpqez HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/kyrbwvrcnkfbzswxkkhvyrkardjhmnrx HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/nfzuigfzdqdcnzqyvgvpfzsjmavfbdwi HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/acpxdcupfgzvzwoytzgipfweooswirjw HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/aqbqklztyvborzanswlvwqblnikaencp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/maojltogglcqgrhsbxudbtdcbtxopbdj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/shsikctypwthzzxpowcyacmnoopuowsl HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/howldjencjwypxvzeogjvzisomqzpqql HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/jdfhsmzrqctwbuhqvdzxwpbejxiexxwu HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "PUT /devstoreaccount1/cont/nimwlqngvvtjhvmvuvbldsjjznmmpfws HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "GET /devstoreaccount1/cont/nfzuigfzdqdcnzqyvgvpfzsjmavfbdwi HTTP/1.1" 206 80
127.0.0.1 - - [09/Sep/2025:13:04:23 +0000] "GET /devstoreaccount1/cont/kyrbwvrcnkfbzswxkkhvyrkardjhmnrx HTTP/1.1" 206 746
127.0.0.1 - - [09/Sep/2025:13:04:24 +0000] "GET /devstoreaccount1/cont/nfzuigfzdqdcnzqyvgvpfzsjmavfbdwi HTTP/1.1" 206 80
127.0.0.1 - - [09/Sep/2025:13:04:24 +0000] "GET /devstoreaccount1/cont/kyrbwvrcnkfbzswxkkhvyrkardjhmnrx HTTP/1.1" 206 746
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/nimwlqngvvtjhvmvuvbldsjjznmmpfws HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/shsikctypwthzzxpowcyacmnoopuowsl HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/aqbqklztyvborzanswlvwqblnikaencp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/kyrbwvrcnkfbzswxkkhvyrkardjhmnrx HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/nfzuigfzdqdcnzqyvgvpfzsjmavfbdwi HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/acpxdcupfgzvzwoytzgipfweooswirjw HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/maojltogglcqgrhsbxudbtdcbtxopbdj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/jdfhsmzrqctwbuhqvdzxwpbejxiexxwu HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/howldjencjwypxvzeogjvzisomqzpqql HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:25 +0000] "DELETE /devstoreaccount1/cont/vlpewwbpywjpicelxshxyofgjzrrpqez HTTP/1.1" 202 -
2025-09-09 15:04:25 02240_system_filesystem_cache_table: [ OK ] 6.79 sec.
2025-09-09 15:04:25 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec.
2025-09-09 15:04:25 Reason: disabled
2025-09-09 15:04:26 02227_test_create_empty_sqlite_db: [ OK ] 1.37 sec.
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/ttqykwvzjcykhydnlzuwcfmyaybnfrny HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/tnibcjhmhdprhzmzkfaosxhvnigqxagw HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/ppjpzuddaeakbdwbkudesplfxwplnmhb HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/rbuchkyruadpgqoypdxvfnhrmhnxlvwb HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/iuxnshcigznkviqpzrxpupxagwlccrky HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/bybkpqyuqipykpdklccavrijgwromuxl HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/pfhitqdudbncmbrezcoupwximvazcmjh HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/heqskmuhkxrkcmyqpbddvfmmjupfaftj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/zagypqanxeyuzyzxmpkgjclfremnxymd HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "PUT /devstoreaccount1/cont/ojzkokdvhtejsuqckpyxwyabdqdzldrp HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "GET /devstoreaccount1/cont/ppjpzuddaeakbdwbkudesplfxwplnmhb HTTP/1.1" 206 62
127.0.0.1 - - [09/Sep/2025:13:04:30 +0000] "GET /devstoreaccount1/cont/tnibcjhmhdprhzmzkfaosxhvnigqxagw HTTP/1.1" 206 100165
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/fpqdatqfuoiwjzzoupxyakdpersidnds HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/yyrltnujwihdnmdangxsucqqkgrzrlvf HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/zbcbzqwxgirehbnkhzohtnersceootca HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/ghihvrjdkjtebnaoycrmhwhshcpetgje HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/arzaehxfaftraqxhysmmeuuriswmlrbe HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/ojzkokdvhtejsuqckpyxwyabdqdzldrp HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/pfhitqdudbncmbrezcoupwximvazcmjh HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/iuxnshcigznkviqpzrxpupxagwlccrky HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/ppjpzuddaeakbdwbkudesplfxwplnmhb HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/tnibcjhmhdprhzmzkfaosxhvnigqxagw HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/rbuchkyruadpgqoypdxvfnhrmhnxlvwb HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/bybkpqyuqipykpdklccavrijgwromuxl HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/zagypqanxeyuzyzxmpkgjclfremnxymd HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "DELETE /devstoreaccount1/cont/heqskmuhkxrkcmyqpbddvfmmjupfaftj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/mujdihlhdsyfcpfcrqqhitmlxaenahaj HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/hsntislvwqvhlzodaczrcwwnyeucehul HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/slunjhbdrepodwdikgphekbawfmhjlib HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/itnzbtekkbrnpwbmyctrvgoaeuiyfeql HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/gwhhcytcyipnvstmbleghfgvpvhsyaqq HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/efygmbomdbndfzmizrayuoonujrvdkyv HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/lmobqqgepyfmgcvdhcdsfisolujwlcpk HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/mbewmyuxxvcfmezgnhhpaplujarzrvha HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:31 +0000] "PUT /devstoreaccount1/cont/clxhvxughvntylwjiejncnoewhhfdgpl HTTP/1.1" 201 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/arzaehxfaftraqxhysmmeuuriswmlrbe HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/yyrltnujwihdnmdangxsucqqkgrzrlvf HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/fpqdatqfuoiwjzzoupxyakdpersidnds HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/xtuhxsavqbxkepyzbgkvegrqilfvwzyz HTTP/1.1" 404 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/pksduegpcqocqxfzbrbllakarjbycvor HTTP/1.1" 404 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/ewvkhvmrrghvdcbyabiehcaljpoeayef HTTP/1.1" 404 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/ghihvrjdkjtebnaoycrmhwhshcpetgje HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/zbcbzqwxgirehbnkhzohtnersceootca HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/clxhvxughvntylwjiejncnoewhhfdgpl HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/efygmbomdbndfzmizrayuoonujrvdkyv HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/itnzbtekkbrnpwbmyctrvgoaeuiyfeql HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/hsntislvwqvhlzodaczrcwwnyeucehul HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/mujdihlhdsyfcpfcrqqhitmlxaenahaj HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/slunjhbdrepodwdikgphekbawfmhjlib HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/gwhhcytcyipnvstmbleghfgvpvhsyaqq HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/mbewmyuxxvcfmezgnhhpaplujarzrvha HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/lmobqqgepyfmgcvdhcdsfisolujwlcpk HTTP/1.1" 202 -
127.0.0.1 - - [09/Sep/2025:13:04:32 +0000] "DELETE /devstoreaccount1/cont/ttqykwvzjcykhydnlzuwcfmyaybnfrny HTTP/1.1" 202 -
2025-09-09 15:04:32 02226_filesystem_cache_profile_events: [ OK ] 5.58 sec.
2025-09-09 15:04:33 02225_unwinder_dwarf_version: [ OK ] 0.87 sec.
2025-09-09 15:04:36 02222_create_table_without_columns_metadata: [ OK ] 3.63 sec.
2025-09-09 15:04:39 02207_allow_plaintext_and_no_password: [ OK ] 2.32 sec.
2025-09-09 15:04:41 02185_values_schema_inference: [ OK ] 1.97 sec.
2025-09-09 15:04:42 02184_ipv6_parsing: [ OK ] 1.12 sec.
2025-09-09 15:04:43 02182_json_each_row_schema_inference: [ OK ] 0.92 sec.
2025-09-09 15:04:43 02179_dict_reload_on_cluster: [ OK ] 0.47 sec.
2025-09-09 15:04:44 02177_temporary_table_current_database_http_session: [ OK ] 0.62 sec.
2025-09-09 15:04:44 02168_avro_bug: [ OK ] 0.37 sec.
2025-09-09 15:04:45 02166_arrow_dictionary_inference: [ OK ] 1.12 sec.
2025-09-09 15:04:46 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.47 sec.
2025-09-09 15:04:46 02148_sql_user_defined_function_subquery: [ OK ] 0.42 sec.
2025-09-09 15:04:47 02126_identity_user_defined_function: [ OK ] 0.37 sec.
2025-09-09 15:04:47 02125_recursive_sql_user_defined_functions: [ OK ] 0.42 sec.
2025-09-09 15:04:47 02125_many_mutations_2: [ SKIPPED ] 0.00 sec.
2025-09-09 15:04:47 Reason: not running for current build
2025-09-09 15:04:49 02105_table_function_file_partiotion_by: [ OK ] 1.77 sec.
2025-09-09 15:04:50 02104_json_strings_nullable_string: [ OK ] 1.12 sec.
2025-09-09 15:04:50 02103_sql_user_defined_functions_composition: [ OK ] 0.37 sec.
2025-09-09 15:04:56 02103_tsv_csv_custom_null_representation: [ OK ] 6.13 sec.
2025-09-09 15:04:57 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.37 sec.
2025-09-09 15:04:57 02098_sql_user_defined_functions_aliases: [ OK ] 0.32 sec.
2025-09-09 15:04:57 02096_sql_user_defined_function_alias: [ OK ] 0.32 sec.
2025-09-09 15:04:58 02096_rename_atomic_hang: [ OK ] 0.42 sec.
2025-09-09 15:05:00 02051_read_settings: [ OK ] 1.58 sec.
2025-09-09 15:05:00 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.72 sec.
2025-09-09 15:05:12 02026_storage_filelog_largefile: [ OK ] 12.10 sec.
2025-09-09 15:05:13 02025_dictionary_view_different_db: [ OK ] 0.42 sec.
2025-09-09 15:05:13 02015_column_default_dict_get_identifier: [ OK ] 0.42 sec.
2025-09-09 15:05:15 02015_global_in_threads: [ OK ] 1.77 sec.
2025-09-09 15:05:15 02011_dictionary_empty_attribute_list: [ OK ] 0.37 sec.
2025-09-09 15:05:16 01999_grant_with_replace: [ OK ] 0.37 sec.
2025-09-09 15:05:16 01948_dictionary_quoted_database_name: [ OK ] 0.37 sec.
2025-09-09 15:05:17 01915_create_or_replace_dictionary: [ OK ] 0.42 sec.
2025-09-09 15:05:17 01913_exact_rows_before_limit_full: [ OK ] 0.42 sec.
2025-09-09 15:05:17 01910_view_dictionary: [ OK ] 0.42 sec.
2025-09-09 15:05:18 01903_ssd_cache_dictionary_array_type: [ OK ] 0.92 sec.
2025-09-09 15:05:19 01902_table_function_merge_db_repr: [ OK ] 0.52 sec.
2025-09-09 15:05:20 01901_test_attach_partition_from: [ OK ] 1.47 sec.
2025-09-09 15:05:21 01889_postgresql_protocol_null_fields: [ OK ] 0.92 sec.
2025-09-09 15:05:22 01870_buffer_flush: [ OK ] 0.37 sec.
2025-09-09 15:05:22 01856_create_function: [ OK ] 0.47 sec.
2025-09-09 15:05:24 01853_dictionary_cache_duplicates: [ OK ] 1.78 sec.
2025-09-09 15:05:24 01850_dist_INSERT_preserve_error: [ OK ] 0.42 sec.
2025-09-09 15:05:25 01837_database_memory_ddl_dictionaries: [ OK ] 0.32 sec.
2025-09-09 15:05:25 01821_table_comment: [ OK ] 0.37 sec.
2025-09-09 15:05:26 01785_dictionary_element_count: [ OK ] 0.52 sec.
2025-09-09 15:05:26 01778_hierarchical_dictionaries: [ OK ] 0.52 sec.
2025-09-09 15:05:27 01754_direct_dictionary_complex_key: [ OK ] 0.72 sec.
2025-09-09 15:05:28 01753_direct_dictionary_simple_key: [ OK ] 0.72 sec.
2025-09-09 15:05:29 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.07 sec.
2025-09-09 15:05:30 01746_executable_pool_dictionary: [ OK ] 1.07 sec.
2025-09-09 15:05:32 01737_clickhouse_server_wait_server_pool_long: [ OK ] 2.02 sec.
2025-09-09 15:05:34 01722_long_brotli_http_compression_json_format: [ OK ] 1.57 sec.
2025-09-09 15:05:34 01721_engine_file_truncate_on_insert: [ OK ] 0.42 sec.
2025-09-09 15:05:38 01710_projection_vertical_merges: [ OK ] 3.88 sec.
2025-09-09 15:05:39 01681_cache_dictionary_simple_key: [ OK ] 0.62 sec.
2025-09-09 15:05:39 01676_dictget_in_default_expression: [ OK ] 0.42 sec.
2025-09-09 15:05:39 01670_dictionary_create_key_expression: [ OK ] 0.42 sec.
2025-09-09 15:05:40 01646_system_restart_replicas_smoke: [ OK ] 0.37 sec.
2025-09-09 15:05:41 01643_replicated_merge_tree_fsync_smoke: [ OK ] 1.12 sec.
2025-09-09 15:05:41 01615_random_one_shard_insertion: [ OK ] 0.52 sec.
2025-09-09 15:05:42 01603_rename_overwrite_bug: [ OK ] 0.42 sec.
2025-09-09 15:06:04 01600_detach_permanently: [ OK ] 22.20 sec.
2025-09-09 15:06:50 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 45.49 sec.
2025-09-09 15:06:50 01575_disable_detach_table_of_dictionary: [ OK ] 0.37 sec.
2025-09-09 15:06:51 01530_drop_database_atomic_sync: [ OK ] 0.57 sec.
2025-09-09 15:06:52 01527_clickhouse_local_optimize: [ OK ] 0.97 sec.
2025-09-09 15:06:52 01526_complex_key_dict_direct_layout: [ OK ] 0.37 sec.
2025-09-09 15:06:53 01524_do_not_merge_across_partitions_select_final: [ OK ] 0.97 sec.
2025-09-09 15:06:53 01517_drop_mv_with_inner_table: [ OK ] 0.47 sec.
2025-09-09 15:06:56 01507_clickhouse_server_start_with_embedded_config: [ OK ] 2.73 sec.
2025-09-09 15:06:57 01501_cache_dictionary_all_fields: [ OK ] 1.22 sec.
2025-09-09 15:06:59 01474_executable_dictionary: [ OK ] 2.07 sec.
2025-09-09 15:07:00 01471_calculate_ttl_during_merge: [ OK ] 0.42 sec.
2025-09-09 15:07:17 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 16.81 sec.
2025-09-09 15:07:17 01459_manual_write_to_replicas: [ SKIPPED ] 0.00 sec.
2025-09-09 15:07:17 Reason: not running for current build
2025-09-09 15:07:17 01457_create_as_table_function_structure: [ OK ] 0.42 sec.
2025-09-09 15:07:18 01455_rank_correlation_spearman: [ OK ] 0.42 sec.
2025-09-09 15:07:39 01454_storagememory_data_race_challenge: [ OK ] 21.48 sec.
2025-09-09 15:07:43 01417_freeze_partition_verbose_zookeeper: [ OK ] 4.08 sec.
2025-09-09 15:07:50 01417_freeze_partition_verbose: [ OK ] 6.94 sec.
2025-09-09 15:08:34 01414_mutations_and_errors_zookeeper: [ OK ] 44.14 sec.
2025-09-09 15:08:37 01410_nullable_key_more_tests: [ OK ] 2.58 sec.
2025-09-09 15:08:41 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 3.98 sec.
2025-09-09 15:08:43 01360_materialized_view_with_join_on_query_log: [ OK ] 1.88 sec.
2025-09-09 15:08:43 01356_view_threads: [ OK ] 0.62 sec.
2025-09-09 15:08:55 01320_create_sync_race_condition_zookeeper: [ OK ] 11.35 sec.
2025-09-09 15:09:00 01307_multiple_leaders_zookeeper: [ OK ] 4.73 sec.
2025-09-09 15:09:11 01305_replica_create_drop_zookeeper: [ OK ] 11.20 sec.
2025-09-09 15:09:42 01301_aggregate_state_exception_memory_leak: [ OK ] 31.05 sec.
2025-09-09 15:09:43 01297_create_quota: [ OK ] 0.67 sec.
2025-09-09 15:09:43 01295_create_row_policy: [ OK ] 0.42 sec.
2025-09-09 15:09:43 01294_system_distributed_on_cluster: [ OK ] 0.52 sec.
2025-09-09 15:09:44 01294_create_settings_profile: [ OK ] 0.57 sec.
2025-09-09 15:09:44 01293_system_distribution_queue: [ OK ] 0.42 sec.
2025-09-09 15:09:45 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.42 sec.
2025-09-09 15:09:49 01281_group_by_limit_memory_tracking: [ OK ] 3.98 sec.
2025-09-09 15:09:52 01280_ssd_complex_key_dictionary: [ OK ] 2.73 sec.
2025-09-09 15:10:48 01275_parallel_mv: [ OK ] 56.57 sec.
2025-09-09 15:10:49 01251_dict_is_in_infinite_loop: [ OK ] 0.57 sec.
2025-09-09 15:10:49 01225_show_create_table_from_dictionary: [ OK ] 0.27 sec.
2025-09-09 15:11:23 01192_rename_database_zookeeper: [ OK ] 33.81 sec.
2025-09-09 15:11:23 01164_alter_memory_database: [ OK ] 0.32 sec.
2025-09-09 15:11:24 01155_rename_move_materialized_view: [ OK ] 0.72 sec.
2025-09-09 15:12:24 01154_move_partition_long: [ OK ] 59.88 sec.
2025-09-09 15:12:24 01153_attach_mv_uuid: [ OK ] 0.47 sec.
2025-09-09 15:12:25 01148_zookeeper_path_macros_unfolding: [ OK ] 0.77 sec.
2025-09-09 15:12:26 01119_weird_user_names: [ OK ] 0.42 sec.
2025-09-09 15:17:39 01111_create_drop_replicated_db_stress: [ OK ] 313.58 sec.
2025-09-09 15:17:39 01110_dictionary_layout_without_arguments: [ OK ] 0.27 sec.
2025-09-09 15:17:40 01103_distributed_product_mode_local_column_renames: [ OK ] 0.52 sec.
2025-09-09 15:17:47 01098_temporary_and_external_tables: [ OK ] 6.84 sec.
2025-09-09 15:17:48 01091_num_threads: [ OK ] 0.92 sec.
2025-09-09 15:17:49 01085_max_distributed_connections_http: [ OK ] 1.57 sec.
2025-09-09 15:18:22 01083_expressions_in_engine_arguments: [ OK ] 32.61 sec.
2025-09-09 15:18:23 01082_window_view_watch_limit: [ OK ] 0.97 sec.
2025-09-09 15:18:50 01079_parallel_alter_detach_table_zookeeper: [ OK ] 26.69 sec.
2025-09-09 15:18:57 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 6.99 sec.
2025-09-09 15:19:00 01075_window_view_proc_tumble_to_now_populate: [ OK ] 3.68 sec.
2025-09-09 15:19:01 01070_materialize_ttl: [ OK ] 0.67 sec.
2025-09-09 15:19:02 01070_mutations_with_dependencies: [ OK ] 0.62 sec.
2025-09-09 15:19:02 01070_modify_ttl: [ OK ] 0.67 sec.
2025-09-09 15:19:11 01069_window_view_proc_tumble_watch: [ OK ] 8.94 sec.
2025-09-09 15:19:13 01065_window_view_event_hop_watch_bounded: [ OK ] 1.17 sec.
2025-09-09 15:19:14 01060_shutdown_table_after_detach: [ OK ] 0.97 sec.
2025-09-09 15:19:20 01055_window_view_proc_hop_to: [ OK ] 6.44 sec.
2025-09-09 15:19:22 01053_ssd_dictionary: [ OK ] 2.17 sec.
2025-09-09 15:19:26 01038_dictionary_lifetime_min_zero_sec: [ OK ] 3.33 sec.
2025-09-09 15:19:26 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.37 sec.
2025-09-09 15:19:26 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.37 sec.
2025-09-09 15:19:27 01023_materialized_view_query_context: [ OK ] 0.42 sec.
2025-09-09 15:19:39 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 12.05 sec.
2025-09-09 15:19:42 01018_ddl_dictionaries_bad_queries: [ OK ] 3.08 sec.
2025-09-09 15:20:05 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 23.33 sec.
2025-09-09 15:20:21 01014_lazy_database_basic: [ OK ] 15.66 sec.
2025-09-09 15:20:23 01013_sync_replica_timeout_zookeeper: [ OK ] 2.47 sec.
2025-09-09 15:20:36 01007_r1r2_w_r2r1_deadlock: [ OK ] 12.15 sec.
2025-09-09 15:20:49 01004_rename_deadlock: [ OK ] 13.16 sec.
2025-09-09 15:20:50 00985_merge_stack_overflow: [ OK ] 0.97 sec.
2025-09-09 15:20:51 00971_query_id_in_logs: [ OK ] 0.87 sec.
2025-09-09 15:20:51 00963_achimbab: [ OK ] 0.37 sec.
2025-09-09 15:20:52 00950_dict_get: [ OK ] 0.72 sec.
2025-09-09 15:20:54 00877_memory_limit_for_new_delete: [ OK ] 1.97 sec.
2025-09-09 15:20:54 00840_long_concurrent_select_and_drop_deadlock: [ SKIPPED ] 0.00 sec.
2025-09-09 15:20:54 Reason: not running for current build
2025-09-09 15:20:54 00722_inner_join: [ OK ] 0.47 sec.
2025-09-09 15:20:55 00693_max_block_size_system_tables_columns: [ OK ] 0.52 sec.
2025-09-09 15:20:59 00623_truncate_table_throw_exception: [ OK ] 3.83 sec.
2025-09-09 15:20:59 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 0.77 sec.
2025-09-09 15:21:08 00463_long_sessions_in_http_interface: [ OK ] 8.64 sec.
2025-09-09 15:21:08 00332_quantile_timing_memory_leak: [ OK ] 0.37 sec.
2025-09-09 15:21:09 00309_formats_case_insensitive: [ OK ] 0.42 sec.
2025-09-09 15:21:09 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec.
2025-09-09 15:21:09 Reason: skip
2025-09-09 15:21:09
2025-09-09 15:21:09 269 tests passed. 12 tests skipped. 1586.85 s elapsed (MainProcess).
2025-09-09 15:21:09 Won't run stateful tests because test data wasn't loaded.
2025-09-09 15:21:09 Checking the hung queries: done
2025-09-09 15:21:09
2025-09-09 15:21:09 No queries hung.
2025-09-09 15:21:09
2025-09-09 15:21:09 Some tests were restarted:
2025-09-09 15:21:09
2025-09-09 15:21:09
2025-09-09 15:21:09 02221_parallel_replicas_bug :
2025-09-09 15:21:09 [ fail ] 1.82 sec.
2025-09-09 15:21:09 Reason: having stderror:
2025-09-09 15:21:09 [a3c889a04a2b] 2025.09.09 05:45:24.910303 [ 26815 ] {ff604ab4-a226-4494-b348-801bd5058a7a} ConnectionPoolWithFailover: Connection failed at try №1, reason: Code: 210. DB::NetException: Connection refused (127.0.0.3:1234). (NETWORK_ERROR) (version 24.8.14.10504.altinitytest (altinity build))
2025-09-09 15:21:09
2025-09-09 15:21:09 stdout:
2025-09-09 15:21:09
2025-09-09 15:21:09
2025-09-09 15:21:09 Settings used in the test: --max_insert_threads 1 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 23176968 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 4015363 --max_read_buffer_size 953856 --prefer_localhost_replica 1 --max_block_size 82428 --max_joined_block_size_rows 17848 --max_threads 2 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 10 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 45723965 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 8550696843 --min_bytes_to_use_mmap_io 4996254568 --local_filesystem_read_method pread_threadpool --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 1 --compile_sort_description 1 --merge_tree_coarse_index_granularity 23 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 1298314648 --min_compress_block_size 228297 --max_compress_block_size 872218 --merge_tree_compact_parts_min_granules_to_multibuffer_read 80 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 8122920 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Mexico/BajaSur --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.94 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 10 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 1
2025-09-09 15:21:09
2025-09-09 15:21:09 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.049566067906680056 --prefer_fetch_merged_part_size_threshold 6132240636 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 23463540 --merge_max_block_size 15254 --index_granularity 52908 --min_bytes_for_wide_part 914551576 --marks_compress_block_size 26797 --primary_key_compress_block_size 48998 --replace_long_file_name_to_hash 0 --max_file_name_length 128 --min_bytes_for_full_part_storage 150573028 --compact_parts_max_bytes_to_buffer 219424031 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 1205675 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 3 --old_parts_lifetime 343
2025-09-09 15:21:09
2025-09-09 15:21:09 Database: test_xkfuxk9b
2025-09-09 15:21:09 All tests have finished.
2025-09-09 15:21:09
2025-09-09 15:21:09 Top patterns of log messages:
2025-09-09 15:21:09
2025-09-09 15:21:09 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2025-09-09 15:21:09
2025-09-09 15:21:09 1. 127108 0.044 24.91 MiB 0.083 1 344 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2025-09-09 15:21:09 2. 127048 0.044 19.02 MiB 0.063 39678 339 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2025-09-09 15:21:09 3. 115410 0.04 2.76 MiB 0.009 1 820 ['Trace'] 0.001 Query to stage {}{}
2025-09-09 15:21:09 4. 114021 0.039 5.36 MiB 0.018 1 819 ['Trace'] 0.001 Query from stage {} to stage {}{}
2025-09-09 15:21:09 5. 110669 0.038 4.84 MiB 0.016 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2025-09-09 15:21:09 6. 103639 0.036 2.86 MiB 0.009 1 243 ['Debug'] 0 Processed in {} sec.
2025-09-09 15:21:09 7. 74888 0.026 2.41 MiB 0.008 1 1574 ['Trace'] 0 Aggregation method: {}
2025-09-09 15:21:09 8. 74759 0.026 5.92 MiB 0.02 1 323 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2025-09-09 15:21:09 9. 70044 0.024 6.27 MiB 0.021 1 1573 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2025-09-09 15:21:09 10. 64795 0.022 4.45 MiB 0.015 1 2021 ['Trace'] 0.501 Reserved {} on local disk {}, having unreserved {}.
2025-09-09 15:21:09 11. 60743 0.021 6.79 MiB 0.023 2825 1522 ['Trace'] 0.375 Renaming temporary part {} to {} with tid {}.
2025-09-09 15:21:09 12. 59037 0.02 634.19 KiB 0.002 1 1523 ['Trace'] 0 Aggregating
2025-09-09 15:21:09 13. 57728 0.02 3.91 MiB 0.013 2813 2009 ['Trace'] 0.458 Trying to reserve {} using storage policy from min volume index {}
2025-09-09 15:21:09 14. 56109 0.019 4.46 MiB 0.015 1 1532 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2025-09-09 15:21:09 15. 46600 0.016 2.11 MiB 0.007 1 1509 ['Trace'] 0.142 filled checksums {}
2025-09-09 15:21:09 16. 41341 0.014 1.95 MiB 0.006 1 289 ['Debug'] 0.224 Peak memory usage{}: {}.
2025-09-09 15:21:09 17. 40301 0.014 1.82 MiB 0.006 40301 501 ['Debug'] 0.996 Authenticating user '{}' from {}
2025-09-09 15:21:09 18. 40273 0.014 4.42 MiB 0.015 40273 501 ['Debug'] 0.996 {} Authenticated with global context as user {}
2025-09-09 15:21:09 19. 40222 0.014 3.45 MiB 0.011 40222 496 ['Debug'] 0.996 {} Logout, user_id: {}
2025-09-09 15:21:09 20. 39865 0.014 2.85 MiB 0.009 39865 339 ['Debug'] 1 Creating session context with user_id: {}
2025-09-09 15:21:09 21. 38238 0.013 2.94 MiB 0.01 1598 313 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2025-09-09 15:21:09 22. 37043 0.013 7.54 MiB 0.025 3 322 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2025-09-09 15:21:09 23. 37034 0.013 21.18 MiB 0.07 2 322 ['Trace'] 1 Request URI: {}
2025-09-09 15:21:09 24. 35457 0.012 727.15 KiB 0.002 2 322 ['Debug'] 0.422 Done processing query
2025-09-09 15:21:09 25. 32536 0.011 2.85 MiB 0.009 443 521 ['Trace'] 0.999 Insert entry {} to queue with type {}
2025-09-09 15:21:09 26. 31350 0.011 2.40 MiB 0.008 735 1880 ['Trace'] 0.937 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2025-09-09 15:21:09 27. 27897 0.01 2.32 MiB 0.008 901 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {}
2025-09-09 15:21:09 28. 27599 0.009 3.75 MiB 0.012 655 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2025-09-09 15:21:09 29. 27174 0.009 3.25 MiB 0.011 1 2 ['Trace'] 1 Creating part at path {}
2025-09-09 15:21:09 30. 26716 0.009 2.40 MiB 0.008 1 114 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2025-09-09 15:21:09 31. 25684 0.009 758.50 KiB 0.002 1756 371 ['Debug'] 0.004 Key condition: {}
2025-09-09 15:21:09 32. 25015 0.009 635.15 KiB 0.002 443 521 ['Debug'] 0.999 Pulled {} entries to queue.
2025-09-09 15:21:09 33. 25015 0.009 1.41 MiB 0.005 443 521 ['Debug'] 0.999 Pulling {} entries to queue: {} - {}
2025-09-09 15:21:09 34. 23729 0.008 532.98 KiB 0.002 1 1493 ['Trace'] 0 Merging aggregated data
2025-09-09 15:21:09 35. 23239 0.008 2.33 MiB 0.008 266 33 ['Debug'] 1 Fetching part {} from {}:{}
2025-09-09 15:21:09 36. 22705 0.008 997.78 KiB 0.003 1751 371 ['Trace'] 0.005 Filtering marks by primary and secondary keys
2025-09-09 15:21:09 37. 22436 0.008 2.49 MiB 0.008 1744 371 ['Debug'] 0.005 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2025-09-09 15:21:09 38. 20706 0.007 1.05 MiB 0.003 1509 369 ['Trace'] 0.005 Spreading mark ranges among streams (default reading)
2025-09-09 15:21:09 39. 19524 0.007 638.85 KiB 0.002 2 247 ['Trace'] 1 TCP Request. Address: {}
2025-09-09 15:21:09 40. 19521 0.007 1.84 MiB 0.006 1 247 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2025-09-09 15:21:09 41. 19516 0.007 739.58 KiB 0.002 353 36 ['Debug'] 0.766 Committing part {} to zookeeper
2025-09-09 15:21:09 42. 19448 0.007 512.79 KiB 0.002 1 242 ['Debug'] 1 Done processing connection.
2025-09-09 15:21:09 43. 18630 0.006 686.13 KiB 0.002 350 32 ['Debug'] 0.802 Part {} committed to zookeeper
2025-09-09 15:21:09 44. 17899 0.006 629.27 KiB 0.002 1 121 ['Trace'] 1 Keeper request. Address: {}
2025-09-09 15:21:09 45. 16440 0.006 1.38 MiB 0.005 265 37 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2025-09-09 15:21:09 46. 16440 0.006 594.00 KiB 0.002 265 37 ['Trace'] 1 Checking disk {} with type {}
2025-09-09 15:21:09 47. 15625 0.005 488.28 KiB 0.002 1 118 ['Debug'] 1 Receive four letter command {}
2025-09-09 15:21:09 48. 14964 0.005 323.06 KiB 0.001 215 60 ['Trace'] 1 Sending part {}
2025-09-09 15:21:09 49. 14961 0.005 290.57 KiB 0.001 263 38 ['Debug'] 1 Downloading files {}
2025-09-09 15:21:09 50. 14958 0.005 1.24 MiB 0.004 263 38 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}'
2025-09-09 15:21:09 51. 14954 0.005 658.72 KiB 0.002 260 38 ['Debug'] 1 Downloading part {} onto disk {}.
2025-09-09 15:21:09 52. 14948 0.005 789.82 KiB 0.003 260 38 ['Debug'] 1 Download of part {} onto disk {} finished.
2025-09-09 15:21:09 53. 14943 0.005 1.45 MiB 0.005 263 33 ['Debug'] 1 Fetched part {} from {}:{}{}
2025-09-09 15:21:09 54. 13960 0.005 1.48 MiB 0.005 1 77 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2025-09-09 15:21:09 55. 13126 0.005 842.08 KiB 0.003 78 480 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem
2025-09-09 15:21:09 56. 12842 0.004 990.74 KiB 0.003 1 270 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2025-09-09 15:21:09 57. 12612 0.004 1.49 MiB 0.005 3899 16 ['Trace'] 1 Executing log entry to merge parts {} to {}
2025-09-09 15:21:09 58. 12350 0.004 518.60 KiB 0.002 3575 279 ['Debug'] 0.011 Found {} non used tables in detached tables.
2025-09-09 15:21:09 59. 12350 0.004 735.69 KiB 0.002 3575 279 ['Debug'] 0.011 There are {} detached tables. Start searching non used tables.
2025-09-09 15:21:09 60. 12297 0.004 492.36 KiB 0.002 182 606 ['Debug'] 0.601 Will use old analyzer to prepare mutation
2025-09-09 15:21:09 61. 10063 0.003 2.03 MiB 0.007 1605 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it
2025-09-09 15:21:09 62. 9598 0.003 883.65 KiB 0.003 13 24 ['Debug'] 0 Waiting for currently running merges ({} parts are merging right now) to perform OPTIMIZE FINAL
2025-09-09 15:21:09 63. 9114 0.003 1.21 MiB 0.004 1 208 ['Trace'] 0.017 PREWHERE condition was split into {} steps: {}
2025-09-09 15:21:09 64. 8653 0.003 689.02 KiB 0.002 1 1441 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={}
2025-09-09 15:21:09 65. 8320 0.003 292.50 KiB 0.001 1 1001 ['Trace'] 0.008 Converting aggregated data to blocks
2025-09-09 15:21:09 66. 8320 0.003 243.75 KiB 0.001 896 520 ['Debug'] 0.994 Updating strategy picker state
2025-09-09 15:21:09 67. 8283 0.003 885.99 KiB 0.003 1 997 ['Debug'] 0.005 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.)
2025-09-09 15:21:09 68. 7682 0.003 290.80 KiB 0.001 340 223 ['Debug'] 0.011 Reading approx. {} rows with {} streams
2025-09-09 15:21:09 69. 7507 0.003 366.32 KiB 0.001 679 636 ['Debug'] 0.893 Selected {} parts from {} to {}
2025-09-09 15:21:09 70. 7389 0.003 209.26 KiB 0.001 1 1429 ['Debug'] 1 Stop worker in {}
2025-09-09 15:21:09 71. 7389 0.003 543.94 KiB 0.002 1 1287 ['Debug'] 1 Execute load job '{}' in {}
2025-09-09 15:21:09 72. 7389 0.003 288.64 KiB 0.001 1 1472 ['Debug'] 0.5 Spawn loader worker #{} in {}
2025-09-09 15:21:09 73. 7389 0.003 515.07 KiB 0.002 1 1287 ['Debug'] 1 Finish load job '{}' with status {}
2025-09-09 15:21:09 74. 7389 0.003 565.59 KiB 0.002 1 187 ['Debug'] 0.001 Schedule load job '{}' into {}
2025-09-09 15:21:09 75. 7388 0.003 688.17 KiB 0.002 1 187 ['Debug'] 0 Prioritize load job '{}': {} -> {}
2025-09-09 15:21:09 76. 7363 0.003 64.71 KiB 0 2 187 ['Trace'] 0.001 No tables
2025-09-09 15:21:09 77. 7346 0.003 243.91 KiB 0.001 1 1469 ['Debug'] 0.5 Change current priority: {} -> {}
2025-09-09 15:21:09 78. 7222 0.002 244.53 KiB 0.001 367 179 ['Debug'] 0.001 MinMax index condition: {}
2025-09-09 15:21:09 79. 6992 0.002 207.00 KiB 0.001 249 1425 ['Trace'] 0.009 Found (RIGHT) boundary mark: {}
2025-09-09 15:21:09 80. 6992 0.002 486.90 KiB 0.002 249 1425 ['Trace'] 0.009 Running binary search on index range for part {} ({} marks)
2025-09-09 15:21:09 81. 6992 0.002 199.68 KiB 0.001 249 1425 ['Trace'] 0.009 Found (LEFT) boundary mark: {}
2025-09-09 15:21:09 82. 6992 0.002 213.32 KiB 0.001 249 1425 ['Trace'] 0.009 Found {} range {}in {} steps
2025-09-09 15:21:09 83. 6809 0.002 445.51 KiB 0.001 62 21 ['Information'] 1 Fetching of part was cancelled
2025-09-09 15:21:09 84. 6674 0.002 829.89 KiB 0.003 10 510 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now.
2025-09-09 15:21:09 85. 6596 0.002 1.29 MiB 0.004 1 1403 ['Information'] 1 Removing metadata {} of dropped table {}
2025-09-09 15:21:09 86. 6594 0.002 489.40 KiB 0.002 1 209 ['Debug'] 0 Waiting for table {} to be finally dropped
2025-09-09 15:21:09 87. 6594 0.002 759.86 KiB 0.002 1 209 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {}
2025-09-09 15:21:09 88. 6409 0.002 387.75 KiB 0.001 37 32 ['Debug'] 1 Part {} is rendered obsolete by fetching part {}
2025-09-09 15:21:09 89. 6211 0.002 448.86 KiB 0.001 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables
2025-09-09 15:21:09 90. 5798 0.002 1.10 MiB 0.004 1 310 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {}
2025-09-09 15:21:09 91. 5578 0.002 737.90 KiB 0.002 2251 1630 ['Debug'] 0.977 Removing {} parts from filesystem (serially): Parts: [{}]
2025-09-09 15:21:09 92. 5554 0.002 202.57 KiB 0.001 18 18 ['Trace'] 1 Flushed system log up to offset {}
2025-09-09 15:21:09 93. 5554 0.002 325.16 KiB 0.001 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {}
2025-09-09 15:21:09 94. 5543 0.002 189.28 KiB 0.001 1 130 ['Debug'] 0 Selected MergeAlgorithm: {}
2025-09-09 15:21:09 95. 5543 0.002 437.42 KiB 0.001 1 130 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2025-09-09 15:21:09 96. 5527 0.002 713.56 KiB 0.002 1 130 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2025-09-09 15:21:09 97. 5515 0.002 325.96 KiB 0.001 523 130 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2025-09-09 15:21:09 98. 5481 0.002 394.75 KiB 0.001 418 628 ['Debug'] 0 Wrote block with ID '{}', {} rows{}
2025-09-09 15:21:09 99. 5245 0.002 381.25 KiB 0.001 1 217 ['Trace'] 0.011 The min valid primary key position for moving to the tail of PREWHERE is {}
2025-09-09 15:21:09 100. 4800 0.002 154.59 KiB 0.001 20 91 ['Debug'] 0 Requested flush up to offset {}
2025-09-09 15:21:09
2025-09-09 15:21:09 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2025-09-09 15:21:09
2025-09-09 15:21:09
2025-09-09 15:21:09
2025-09-09 15:21:09 Top messages without format string (fmt::runtime):
2025-09-09 15:21:09
2025-09-09 15:21:09 count pattern runtime_message line
2025-09-09 15:21:09
2025-09-09 15:21:09 1. 1586 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2025-09-09 15:21:09 2. 26 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 1 ('SEECTwrong'): SEECTwrong. Expected one of: Query, Query with output, EXPLAIN, EXPLAIN, SELECT query, possibly with UNION, list of union elements, SELECT query, subquery, possibly with UNION, SEL ('/executeQuery.cpp',221)
2025-09-09 15:21:09 3. 10 CodeDBExceptionReceivedfromDBExc Code: 206. DB::Exception: Received from 127.1:9000. DB::Exception: No alias for subquery or table function in JOIN (set joined_subquery_requires_alias=0 to disable restriction). While processing ' view(SELECT dummy AS d1, dummy AS d2 FROM system.one)'. Sta ('/executeQuery.cpp',221)
2025-09-09 15:21:09 4. 8 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_1.data_02346?. Stack trace:
2025-09-09 15:21:09
2025-09-09 15:21:09 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String ('/executeQuery.cpp',221)
2025-09-09 15:21:09 5. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:38348) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221)
2025-09-09 15:21:09 6. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221)
2025-09-09 15:21:09 7. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:52544) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221)
2025-09-09 15:21:09 8. 4 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:48380) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221)
2025-09-09 15:21:09 9. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10504.a ('/executeQuery.cpp',221)
2025-09-09 15:21:09 10. 2 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10504.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:32852) (in query: ), Stack trace (when copying this message, always include the lines below):
2025-09-09 15:21:09
2025-09-09 15:21:09 0. /build/contrib/llvm-projec ('/executeQuery.cpp',221)
2025-09-09 15:21:09 11. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE), Stack ('/TCPHandler.cpp',765)
2025-09-09 15:21:09 12. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221)
2025-09-09 15:21:09 13. 1 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 14. 1 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 15. 1 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 16. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:53442) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap ('/executeQuery.cpp',221)
2025-09-09 15:21:09 17. 1 createsnapshotidxlogtermdoneusel create snapshot idx 100000 log_term 1 done: 150 us elapsed ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 18. 1 ELECTIONTIMEOUTcurrentrolefollow [ELECTION TIMEOUT] current role: follower, log last term 0, state term 0, target p 1, my p 1, hb dead, pre-vote NOT done ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 19. 1 snapshotidxlogtermcreatedcompact snapshot idx 100000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 20. 1 PocoExceptionCodeecodeBadURIsynt Poco::Exception. Code: 1000, e.code() = 0, Bad URI syntax: URI contains invalid characters (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:47934) (comment: 00746_sql_fuzzy.sh) (in query: SELECT * FROM zeros_mt([], (CAST((( SELECT * FROM c ('/executeQuery.cpp',221)
2025-09-09 15:21:09 21. 1 startingup starting up ('',0)
2025-09-09 15:21:09 22. 1 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10504.altinitytest (revision: 4294967295, git hash: 47ca18fc15f95cf1ab84efa6baa9699b95dcf505, build id: 548596FCB8DB82CD3B0A0E0CF2A64F38B37DC6A7), PID 616 ('',0)
2025-09-09 15:21:09 23. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2025-09-09 15:21:09
2025-09-09 15:21:09 0. /build/contrib/llvm-project/libcxx/include/exception:14 ('/TCPHandler.cpp',765)
2025-09-09 15:21:09 24. 1 stdexceptionCodetypestdfsfilesys std::exception. Code: 1001, type: std::__1::__fs::filesystem::filesystem_error, e.what() = filesystem error: in file_size: Is a directory ["/var/lib/clickhouse/user_files/"]
2025-09-09 15:21:09 Cannot print extra info for Poco::Exception (version 24.8.14.10504.altinitytest (a ('/executeQuery.cpp',221)
2025-09-09 15:21:09 25. 1 RaftASIOlistenerinitiatedonunsec Raft ASIO listener initiated on :::9234, unsecured ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 26. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2025-09-09 15:21:09
2025-09-09 15:21:09 0. /build/contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char ('/TCPHandler.cpp',765)
2025-09-09 15:21:09 27. 1 CodeDBExceptionBadURIsyntaxURIco Code: 1000. DB::Exception: Bad URI syntax: URI contains invalid characters. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2025-09-09 15:21:09
2025-09-09 15:21:09 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::URISyntaxException::U ('/TCPHandler.cpp',765)
2025-09-09 15:21:09 28. 1 newconfiglogidxprevlogidxcurconf new config log idx 1, prev log idx 0, cur config log idx 0, prev log idx 0 ('/LoggerWrapper.h',43)
2025-09-09 15:21:09 29. 1 parameterselectiontimeoutrangehe parameters: election timeout range 0 - 0, heartbeat 0, leadership expiry 0, max batch 100, backoff 50, snapshot distance 100000, enable randomized snapshot creation NO, log sync stop gap 99999, reserved logs 2147483647, client timeout 10000, auto forwardin ('/LoggerWrapper.h',43)
2025-09-09 15:21:14 30. 1 logTraceFunctionTest logTrace Function Test ('/logTrace.cpp',50)
2025-09-09 15:21:14
2025-09-09 15:21:14
2025-09-09 15:21:14
2025-09-09 15:21:14 Top messages not matching their format strings:
2025-09-09 15:21:14
2025-09-09 15:21:14 message_format_string count() any_message
2025-09-09 15:21:14
2025-09-09 15:21:14 1. 1618 std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:53442) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap, UInt64);), Stack trace (when copying this message, always include the lines below):
2025-09-09 15:21:14
2025-09-09 15:21:14 0. /build/contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char const*) @ 0x000000001851bc54
2025-09-09 15:21:14 1. /build/contrib/croaring/cpp/roaring64map.hh:1186: roaring::Roaring64Map::readSafe(char const*, unsigned long) @ 0x000000000ff676b1
2025-09-09 15:21:14 2. /build/contrib/llvm-project/libcxx/include/new:246: _ZN2DB25RoaringBitmapWithSmallSetImLDu32EE4readERNS_10ReadBufferE @ 0x000000000ff670e5
2025-09-09 15:21:14 3. /build/src/DataTypes/Serializations/SerializationAggregateFunction.cpp:0: DB::deserializeFromString(std::shared_ptr const&, DB::IColumn&, String const&, unsigned long) @ 0x0000000010cdbb52
2025-09-09 15:21:14 4. /build/contrib/llvm-project/libcxx/include/string:1499: DB::SerializationAggregateFunction::deserializeWholeText(DB::IColumn&, DB::ReadBuffer&, DB::FormatSettings const&) const @ 0x0000000010cdbdbe
2025-09-09 15:21:14 5. /build/src/IO/BufferBase.h:41: DB::(anonymous namespace)::ConvertImplGenericFromString::execute(std::vector>&, std::shared_ptr const&, DB::ColumnNullable const*, unsigned long, std::shared_ptr const&) @ 0x0000000007100350
2025-09-09 15:21:14 6. /build/contrib/llvm-project/libcxx/include/__functional/function.h:717: ? @ 0x00000000072a1021
2025-09-09 15:21:14 7. /build/contrib/llvm-project/libcxx/include/vector:432: DB::(anonymous namespace)::ExecutableFunctionCast::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000070f8d90
2025-09-09 15:21:14 8. /build/src/Functions/IFunction.h:62: DB::IExecutableFunction::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007024b2a
2025-09-09 15:21:14 9. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b67c8f
2025-09-09 15:21:14 10. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::defaultImplementationForConstantArguments(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b67770
2025-09-09 15:21:14 11. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b67c32
2025-09-09 15:21:14 12. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b68689
2025-09-09 15:21:14 13. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69645
2025-09-09 15:21:14 14. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::IdentifierResolveScope&) @ 0x0000000011050d10
2025-09-09 15:21:14 15. /build/contrib/llvm-project/libcxx/include/vector:553: DB::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool, bool) @ 0x0000000011038e9c
2025-09-09 15:21:14 16. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:3910: DB::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&, bool, bool) @ 0x0000000011037fe0
2025-09-09 15:21:14 17. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::QueryAnalyzer::resolveProjectionExpressionNodeList(std::shared_ptr&, DB::IdentifierResolveScope&) @ 0x000000001105e369
2025-09-09 15:21:14 18. /build/contrib/llvm-project/libcxx/include/vector:961: DB::QueryAnalyzer::resolveQuery(std::shared_ptr const&, DB::IdentifierResolveScope&) @ 0x000000001103247e
2025-09-09 15:21:14 19. /build/src/Analyzer/Resolve/QueryAnalyzer.cpp:0: DB::QueryAnalyzer::resolve(std::shared_ptr&, std::shared_ptr const&, std::shared_ptr) @ 0x00000000110317d9
2025-09-09 15:21:14 20. /build/src/Analyzer/Resolve/QueryAnalysisPass.cpp:0: DB::QueryAnalysisPass::run(std::shared_ptr&, std::shared_ptr) @ 0x00000000110310ae
2025-09-09 15:21:14 21. /build/contrib/llvm-project/libcxx/include/vector:547: DB::QueryTreePassManager::run(std::shared_ptr) @ 0x0000000011583caa
2025-09-09 15:21:14 22. /build/src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:0: DB::(anonymous namespace)::buildQueryTreeAndRunPasses(std::shared_ptr const&, DB::SelectQueryOptions const&, std::shared_ptr const&, std::shared_ptr const&) @ 0x0000000011647c56
2025-09-09 15:21:14 23. /build/src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:160: DB::InterpreterSelectQueryAnalyzer::InterpreterSelectQueryAnalyzer(std::shared_ptr const&, std::shared_ptr const&, DB::SelectQueryOptions const&, std::vector> const&) @ 0x0000000011646149
2025-09-09 15:21:14 24. /build/contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007]&, std::shared_ptr const&, DB::SelectQueryOptions const&>(std::shared_ptr&, std::shared_ptr const&, DB::SelectQueryOptions const&) @ 0x0000000011648a44
2025-09-09 15:21:14 25. /build/src/Interpreters/InterpreterFactory.cpp:0: DB::InterpreterFactory::get(std::shared_ptr&, std::shared_ptr, DB::SelectQueryOptions const&) @ 0x00000000115f1ec4
2025-09-09 15:21:14 26. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x00000000119105a9
2025-09-09 15:21:14 27. /build/src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x000000001190c3bd
2025-09-09 15:21:14 28. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x0000000012cb517b
2025-09-09 15:21:14 29. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:593: DB::TCPHandler::run() @ 0x0000000012ccb939
2025-09-09 15:21:14 30. /build/base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000016528987
2025-09-09 15:21:14 31. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x0000000016528e5e
2025-09-09 15:21:14
2025-09-09 15:21:14 message_format_string count() any_message
2025-09-09 15:21:14
2025-09-09 15:21:14 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:36584) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2025-09-09 15:21:14
2025-09-09 15:21:14 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164833b2
2025-09-09 15:21:14 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c650159
2025-09-09 15:21:14 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000700f16c
2025-09-09 15:21:14 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x0000000007af6fcb
2025-09-09 15:21:14 4. /build/src/Functions/FunctionsStringDistance.cpp:0: DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x0000000007af681c
2025-09-09 15:21:14 5. /build/contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000007b007b7
2025-09-09 15:21:14 6. /build/src/Common/PODArray.h:208: DB::FunctionStringDistanceImpl>::vectorVector(DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul>&, unsigned long) @ 0x0000000007b003cf
2025-09-09 15:21:14 7. /build/src/Functions/FunctionsStringSimilarity.h:0: DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000007affc2f
2025-09-09 15:21:14 8. /build/src/Functions/IFunctionAdaptors.h:22: DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000702497a
2025-09-09 15:21:14 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b67ca5
2025-09-09 15:21:14 10. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6871a
2025-09-09 15:21:14 11. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69645
2025-09-09 15:21:14 12. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x0000000011197afd
2025-09-09 15:21:14 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x0000000012fad856
2025-09-09 15:21:14 14. /build/contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000000c90a4b3
2025-09-09 15:21:14 15. /build/src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x0000000012d50749
2025-09-09 15:21:14 16. /build/src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x0000000012d6af69
2025-09-09 15:21:14 17. /build/src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x0000000012d60c10
2025-09-09 15:21:14 18. /build/contrib/llvm-project/libcxx/include/vector:547: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x0000000012d60e9d
2025-09-09 15:21:14 19. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x0000000012d5fd0c
2025-09-09 15:21:14 20. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x0000000012d5f725
2025-09-09 15:21:14 21. /build/src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000012d6ddea
2025-09-09 15:21:14 22. /build/base/base/../base/wide_integer_impl.h:817: ThreadPoolImpl::ThreadFromThreadPool::worker() @ 0x000000000c704d0e
2025-09-09 15:21:14 23. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000000c70a172
2025-09-09 15:21:14 24. ? @ 0x00007f9e6dba0ac3
2025-09-09 15:21:14 25. ? @ 0x00007f9e6dc32850
2025-09-09 15:21:14
2025-09-09 15:21:14 message_format_string count() any_message
2025-09-09 15:21:14
2025-09-09 15:21:14 3. Close WriteBufferFromAzureBlobStorage. {}. 4 Close WriteBufferFromAzureBlobStorage. hjddrqumqlxofdreatqwpynpziqiputf. (LogSeriesLimiter: on interval from 2025-09-09 15:03:48 to 2025-09-09 15:04:11 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage)
2025-09-09 15:21:14 message_format_string count() any_message
2025-09-09 15:21:14
2025-09-09 15:21:14 4. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10504.altinitytest (altinity build)) (from [::1]:53258) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests
2025-09-09 15:21:14 -- Even if the fallback is used, invalid substitutions must throw an exception.
2025-09-09 15:21:14 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below):
2025-09-09 15:21:14
2025-09-09 15:21:14 0. /build/contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000164833b2
2025-09-09 15:21:14 1. /build/src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000000c650159
2025-09-09 15:21:14 2. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000700f16c
2025-09-09 15:21:14 3. /build/contrib/llvm-project/libcxx/include/vector:438: DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000000b5807ab
2025-09-09 15:21:14 4. /build/src/Functions/ReplaceRegexpImpl.h:0: DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x000000000b584eee
2025-09-09 15:21:14 5. /build/contrib/llvm-project/libcxx/include/string:1624: DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000b581b51
2025-09-09 15:21:14 6. /build/src/Functions/IFunction.h:448: DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000700e34a
2025-09-09 15:21:14 7. /build/src/Functions/IFunctionAdaptors.h:28: DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000070249da
2025-09-09 15:21:14 8. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b67c8f
2025-09-09 15:21:14 9. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b6871a
2025-09-09 15:21:14 10. /build/src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x0000000007b69645
2025-09-09 15:21:14 11. /build/contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x0000000010fcb9e1
2025-09-09 15:21:14 12. /build/src/Interpreters/ActionsDAG.cpp:0: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x0000000010fca9f4
2025-09-09 15:21:14 13. /build/src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x0000000012fad512
2025-09-09 15:21:14 14. /build/src/Processors/QueryPlan/ExpressionStep.cpp:20: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x0000000013140694
2025-09-09 15:21:14 15. /build/contrib/llvm-project/libcxx/include/vector:438: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x00000000104c4fba
2025-09-09 15:21:14 16. /build/src/Planner/Planner.cpp:0: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x0000000011654afc
2025-09-09 15:21:14 17. /build/contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x000000001164ef6a
2025-09-09 15:21:14 18. /build/src/Planner/Planner.cpp:0: DB::Planner::buildQueryPlanIfNeeded() @ 0x000000001164a45e
2025-09-09 15:21:14 19. /build/src/Planner/Planner.h:44: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x000000001164864d
2025-09-09 15:21:14 20. /build/src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x000000001191074d
2025-09-09 15:21:14 21. /build/src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x000000001190c3bd
2025-09-09 15:21:14 22. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x0000000012cb517b
2025-09-09 15:21:14 23. /build/contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:593: DB::TCPHandler::run() @ 0x0000000012ccb939
2025-09-09 15:21:14 24. /build/base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000016528987
2025-09-09 15:21:14 25. /build/contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x0000000016528e5e
2025-09-09 15:21:14 26. /build/base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x00000000164d5672
2025-09-09 15:21:14 27. /build/base/poco/Foundation/include/Poco/AutoPtr.h:77: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000164d3383
2025-09-09 15:21:14 28. ? @ 0x00007f9e6dba0ac3
2025-09-09 15:21:14 29. ? @ 0x00007f9e6dc32850
2025-09-09 15:21:14
2025-09-09 15:21:14 message_format_string count() any_message
2025-09-09 15:21:14
2025-09-09 15:21:14 5. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:50170) (comment: 02686_bson3.sql) -- It correctly throws exception about incorrect data:
2025-09-09 15:21:14 SELECT * FROM format(BSONEachRow, 'WatchID Int64, JavaEnable Int16, Title String, GoodEvent Int16, EventTime DateTime, EventDate Date, CounterID Int32, ClientIP Int32, RegionID Int32, UserID Int64, CounterClass Int16, OS Int16, UserAgent Int16, URL String, Referer String, IsRefresh Int16, RefererCategoryID Int16, RefererRegionID Int32, URLCategoryID Int16, URLRegionID Int32, ResolutionWidth Int16, ResolutionHeight Int16, ResolutionDepth Int16, FlashMajor Int16, FlashMinor Int16, FlashMinor2 String, NetMajor Int16, NetMinor Int16, UserAgentMajor Int16, UserAgentMinor String, CookieEnable Int16, JavascriptEnable Int16, IsMobile Int16, MobilePhone Int16, MobilePhoneModel String, Params String, IPNetworkID Int32, TraficSourceID Int16, SearchEngineID Int16, SearchPhrase String, AdvEngineID Int16, IsArtifical Int16, WindowClientWidth Int16, WindowClientHeight Int16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 Int16, SilverlightVersion2 Int16, SilverlightVersion3 Int32, SilverlightVersion4 Int16, PageCharset String, CodeVersion Int32, IsLink Int16, IsDownload Int16, IsNotBounce Int16, FUniqID Int64, OriginalURL String, HID Int32, IsOldCounter Int16, IsEvent Int16, IsParameter Int16, DontCountHits Int16, WithHash Int16, HitColor String, LocalEventTime DateTime, Age Int16, Sex Int16, Income Int16, Interests Int16, Robotness Int16, RemoteIP Int32, WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage String, BrowserCountry String, SocialNetwork String, SocialAction String, HTTPError Int16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, FetchTiming Int32, SocialSourceNetworkID Int16, SocialSourcePage String, ParamPrice Int64, ParamOrderID String, ParamCurrency String, ParamCurrencyID Int16, OpenstatServiceName String, OpenstatCampaignID String, OpenstatAdID String, OpenstatSourceID String, UTMSource String, UTMMedium String, UTMCampaign String, UTMContent String, UTMTerm String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int32', $$^ WatchID c*5/ !p~JavaEnable Title GoodEvent EventTime 7�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnabl�sMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime &�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID ^ WatchID �F�ӓ2qJavaEnable Title GoodEvent EventTime n$�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime ǘ�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage P�amPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID ^ WatchID l!�|�@HJavaEnable Title GoodEvent EventTime �)�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime }�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID ^ WatchID �ǐ=ЌWJavaEnable Title GoodEvent EventTime 8*�Q EventDate > CounterID ClientIP �z�RegionID G UserID � �:6�CounterClass OS UserAgent URL Referer IsRefresh RefererCategoryID RefererRegionID URLCategoryID URLRegionID ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor �OCookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4 PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID OriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime ݞ�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �|3�b.�CLID � WatchID �E&LyJavaEnable Title GoodEvent EventTime J�Q EventDate > CounterID ClientIP �I`RegionID ' UserID q�Jd8CounterClass OS UserAgent URL - http://holodilnik.ru/russia/05jul2013&model=0Referer IsRefresh RefererCategoryID RefererRegionID URLCateParams String, IPNetworkID Int32, TraficSourceID Int16, SearchEngineID Int16, SearchPhrase String, AdvEngineID Int16, IsArtifical Int16, WindowClientWidth Int16, WindowClientHeight Int16, ClientTimeZone Int16, ClientEventTime DateTime, SilverlightVersion1 Int16, SilverlightVersion2 Int16, SilverlightVersion3 Int32, SilverlightVersion4 Int16, PageCharset String, CodeVersion Int32, IsLink Int16, IsDownload Int16, IsNotBounce Int16, FUniqID Int64, OriginalURL String, HID Int32, IsOldCounter Int16, IsEvent Int16, IsParameter Int16, DontCountHits Int16, WithHash Int16, HitColor String, LocalEventTime DateTime, Age Int16, Sex Int16, Income Int16, Interests Int16, Robotness Int16, RemoteIP Int32, WindowName Int32, OpenerName Int32, HistoryLength Int16, BrowserLanguage String, BrowserCountry String, SocialNetwork String, SocialAction String, HTTPError Int16, SendTiming Int32, DNSTiming Int32, ConnectTiming Int32, ResponseStartTiming Int32, ResponseEndTiming Int32, �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �
2025-09-09 15:21:16 o�eCLID � WatchID �k=�pJavaEnable Title GoodEvent EventTime ��Q EventDate > CounterID Clien�Q9�HRegionID G UserID
�Ks}�CounterClass OS UserAgent URL H http://afisha.mail.ru/catalog/314/women.ru/ency=1&page3/?errovat-pinnikiReferer IsRefresh RefererCategoryID RefererRegionID URLCategoryID 0= URLRegionID � ResolutionWidth ResolutionHeight ResolutionDepth FlashMajor FlashMinor FlashMinor2 NetMajor NetMinor UserAgentMajor UserAgentMinor D�CookieEnable JavascriptEnable IsMobile MobilePhone MobilePhoneModel Params IPNetworkID �9 TraficSourceID SearchEngineID SearchPhrase AdvEngineID IsArtifical WindowClientWidth WindowClientHeight ClientTimeZone �ClientEventTime � SilverlightVersion1 SilverlightVersion2 SilverlightVersion3 SilverlightVersion4
PageCharset CodeVersion IsLink IsDownload IsNotBounce FUniqID :�W�mOriginalURL HID IsOldCounter IsEvent IsParameter DontCountHits WithHash HitColor 5LocalEventTime A�Q Age Sex Income Interests Robotness RemoteIP ^DI�WindowName �OpenerName �HistoryLength �BrowserLanguage �BrowserCountry �SocialNetwork SocialAction HTTPError SendTiming DNSTiming ConnectTiming ResponseStartTiming ResponseEndTiming FetchTiming SocialSourceNetworkID SocialSourcePage ParamPrice ParamOrderID ParamCurrency NHParamCurrencyID OpenstatServiceName OpenstatCampaignID OpenstatAdID OpenstatSourceID UTMSource UTMMedium UTMCampaign UTMContent UTMTerm FromTag HasGCLID RefererHash X+�'�URLHash �
�#�\CLID � Wa⋯
2025-09-09 15:21:16
2025-09-09 15:21:16
2025-09-09 15:21:16
2025-09-09 15:21:16 Top short messages:
2025-09-09 15:21:16
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 1. 113 {} Server was built in debug mode. It will work slowly. 26
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 2. 19 Creating {}: {} Creating table test_qn8z2fiz.test: CREATE TABLE IF NOT EXISTS test_qn8z2fiz.test UUID 'e87a2692-3739-4b1c-aa3e-75d1507a9 124
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 3. 12 Froze {} parts Froze 1 parts -13
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10504.altinitytest (altinity buil 29
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10504.altinitytest (altinity buil 29
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10504.altinitytest (altinity bui 27
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 7. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10504.altinitytest (al 29
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 8. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10504.altinitytest (altinity build) 24
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 9. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10504.altinitytest (altinity build 27
2025-09-09 15:21:16 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2025-09-09 15:21:16
2025-09-09 15:21:16 10. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10504.altinitytest (altinity build 25
2025-09-09 15:21:16
2025-09-09 15:21:16
2025-09-09 15:21:16
2025-09-09 15:21:16 Top messages by level:
2025-09-09 15:21:16
2025-09-09 15:21:16 (0.0008381892637543455,'Failed to push block to view {}, {}') Error
2025-09-09 15:21:16 (0.00043163825964553427,'Not enabled four letter command {}') Warning
2025-09-09 15:21:16 (0.0023399879856102253,'Fetching of part was cancelled') Information
2025-09-09 15:21:16 (0.04368344144909487,'(from {}{}{}){}{} {} (stage: {})') Debug
2025-09-09 15:21:16 (0.043662821787009885,'{} Creating query context from {} context, user_id: {}, parent context user: {}') Trace
2025-09-09 15:21:16
2025-09-09 15:21:16
+ set -e
+ echo 'Files in current directory'
+ ls -la ./
Files in current directory
total 129392
drwxr-xr-x 1 root root 4096 Sep 9 15:08 .
drwxr-xr-x 1 root root 4096 Sep 9 15:08 ..
-rw-rw-r-- 1 1000 1000 119 Sep 9 14:38 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 1834 Sep 9 15:04 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Sep 9 15:04 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2050860 Sep 9 15:21 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Sep 9 15:04 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Sep 9 14:38 broken_tests.json
drwxr-x--- 4 root root 4096 Sep 9 15:02 data
drwxr-xr-x 14 root root 3840 Sep 9 14:42 dev
-rwxr-xr-x 1 root root 0 Sep 9 14:42 .dockerenv
drwxr-xr-x 1 root root 4096 Sep 9 14:43 etc
drwxr-x--- 2 root root 4096 Sep 9 15:02 flags
drwxr-x--- 2 root root 4096 Sep 9 15:02 format_schemas
drwxr-xr-x 1 1000 1000 4096 Sep 9 14:43 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Sep 9 15:02 metadata
drwxr-x--- 2 root root 4096 Sep 9 15:02 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio
drwxr-xr-x 4 root root 4096 Sep 9 14:43 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Sep 9 14:42 package_folder
drwxr-x--- 2 root root 4096 Sep 9 15:05 preprocessed_configs
dr-xr-xr-x 315 root root 0 Sep 9 14:42 proc
-rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Sep 9 14:48 queries_02352
-rw-r----- 1 root root 1 Sep 9 15:02 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
-rw-r----- 1 root root 1 Sep 9 15:02 roles.list
drwx------ 1 root root 4096 Sep 9 15:19 root
-rw-r----- 1 root root 1 Sep 9 15:02 row_policies.list
drwxr-xr-x 1 root root 4096 Sep 9 14:43 run
-rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Sep 9 14:43 script.gdb
-rw-r--r-- 1 root root 66026 Sep 9 15:06 server.log
-rw-r----- 1 root root 1 Sep 9 15:02 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 65 Sep 9 15:05 status
drwxr-x--- 4 root root 4096 Sep 9 15:02 store
-rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Sep 9 14:42 sys
drwxrwxr-x 2 1000 1000 4096 Sep 9 14:43 test_output
drwxrwxrwt 1 root root 4096 Sep 9 15:21 tmp
drwxr-x--- 2 root root 4096 Sep 9 15:02 user_files
-rw-r----- 1 root root 1 Sep 9 15:04 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
-rw-r----- 1 root root 36 Sep 9 15:02 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
Files in root directory
+ echo 'Files in root directory'
+ ls -la /
total 129392
drwxr-xr-x 1 root root 4096 Sep 9 15:08 .
drwxr-xr-x 1 root root 4096 Sep 9 15:08 ..
-rw-rw-r-- 1 1000 1000 119 Sep 9 14:38 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 Jan 31 2025 attach_gdb.lib
-rw-r--r-- 1 root root 1834 Sep 9 15:04 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Sep 9 15:04 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2050860 Sep 9 15:21 azurite_log
lrwxrwxrwx 1 root root 7 Sep 11 2024 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Sep 9 15:04 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 966 Sep 9 14:38 broken_tests.json
drwxr-x--- 4 root root 4096 Sep 9 15:02 data
drwxr-xr-x 14 root root 3840 Sep 9 14:42 dev
-rwxr-xr-x 1 root root 0 Sep 9 14:42 .dockerenv
drwxr-xr-x 1 root root 4096 Sep 9 14:43 etc
drwxr-x--- 2 root root 4096 Sep 9 15:02 flags
drwxr-x--- 2 root root 4096 Sep 9 15:02 format_schemas
drwxr-xr-x 1 1000 1000 4096 Sep 9 14:43 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Sep 11 2024 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Sep 11 2024 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Sep 11 2024 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 Jan 31 2025 mc
drwxr-xr-x 2 root root 4096 Sep 11 2024 media
drwxr-x--- 2 root root 4096 Sep 9 15:02 metadata
drwxr-x--- 2 root root 4096 Sep 9 15:02 metadata_dropped
-rwxr-xr-x 1 root root 103174296 Jan 31 2025 minio
drwxr-xr-x 4 root root 4096 Sep 9 14:43 minio_data
drwxr-xr-x 2 root root 4096 Sep 11 2024 mnt
drwxr-xr-x 1 root root 4096 Jan 31 2025 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Sep 9 14:42 package_folder
drwxr-x--- 2 root root 4096 Sep 9 15:05 preprocessed_configs
dr-xr-xr-x 315 root root 0 Sep 9 14:42 proc
-rwxrwxr-x 1 root root 9627 Jan 31 2025 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Sep 9 14:48 queries_02352
-rw-r----- 1 root root 1 Sep 9 15:02 quotas.list
-rw-rw-r-- 1 root root 837 Jan 31 2025 requirements.txt
-rw-r----- 1 root root 1 Sep 9 15:02 roles.list
drwx------ 1 root root 4096 Sep 9 15:19 root
-rw-r----- 1 root root 1 Sep 9 15:02 row_policies.list
drwxr-xr-x 1 root root 4096 Sep 9 14:43 run
-rwxrwxr-x 1 root root 22124 Jan 31 2025 run.sh
lrwxrwxrwx 1 root root 8 Sep 11 2024 sbin -> usr/sbin
-rw-r--r-- 1 root root 747 Sep 9 14:43 script.gdb
-rw-r--r-- 1 root root 66026 Sep 9 15:06 server.log
-rw-r----- 1 root root 1 Sep 9 15:02 settings_profiles.list
-rwxrwxr-x 1 root root 10374 Jan 31 2025 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 Jan 31 2025 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 Jan 31 2025 setup_minio.sh
drwxr-xr-x 2 root root 4096 Sep 11 2024 srv
-rw-r----- 1 root root 65 Sep 9 15:05 status
drwxr-x--- 4 root root 4096 Sep 9 15:02 store
-rw-rw-r-- 1 root root 14015 Jan 31 2025 stress_tests.lib
dr-xr-xr-x 13 root root 0 Sep 9 14:42 sys
drwxrwxr-x 2 1000 1000 4096 Sep 9 14:43 test_output
drwxrwxrwt 1 root root 4096 Sep 9 15:21 tmp
drwxr-x--- 2 root root 4096 Sep 9 15:02 user_files
-rw-r----- 1 root root 1 Sep 9 15:04 users.list
drwxr-xr-x 1 root root 4096 Sep 11 2024 usr
-rw-rw-r-- 1 root root 897 Jan 31 2025 utils.lib
-rw-r----- 1 root root 36 Sep 9 15:02 uuid
drwxr-xr-x 1 root root 4096 Sep 11 2024 var
+ /process_functional_tests_result.py
2025-09-09 15:21:16,178 File /analyzer_tech_debt.txt with broken tests found
2025-09-09 15:21:16,179 File /broken_tests.json with broken tests found
2025-09-09 15:21:16,179 Broken tests in the list: 4
2025-09-09 15:21:16,179 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log
2025-09-09 15:21:16,196 Is flaky check: False
2025-09-09 15:21:16,196 Result parsed
2025-09-09 15:21:16,201 Result written
+ clickhouse-client -q 'system flush logs'
Detach all logs replication
+ stop_logs_replication
+ echo 'Detach all logs replication'
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ tee /dev/stderr
+ timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ sleep 1
+ clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE'
+ clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ sudo clickhouse stop
script.gdb:13: Error in sourced command file:
No stack.
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Sent terminate signal to process with pid 616.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 616.
The process with pid = 616 does not exist.
Server stopped
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ kill 1504
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
+ :
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ data_path_config=--path=/var/lib/clickhouse/
+ [[ -n '' ]]
+ zstd --threads=0
+ '[' 0 -ne 0 ']'
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
+ zstd --threads=0
format TabSeparated'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ check_logs_for_critical_errors
+ sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log
+ rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp
+ echo -e 'No sanitizer asserts\tOK\t\N\t'
+ rm -f /test_output/tmp
+ rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t'
+ rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No logical errors\tOK\t\N\t'
+ '[' -s /test_output/logical_errors.txt ']'
+ rm /test_output/logical_errors.txt
+ rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep -v a.myext
+ echo -e 'No lost s3 keys\tOK\t\N\t'
+ rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep SharedMergeTreePartCheckThread
+ echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/no_such_key_errors.txt ']'
+ rm /test_output/no_such_key_errors.txt
+ rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'Not crashed\tOK\t\N\t'
+ rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/fatal_messages.txt ']'
+ rm /test_output/fatal_messages.txt
+ rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst
+ rg -Fa ' received signal ' /test_output/gdb.log
+ dmesg -T
+ grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log
+ echo -e 'No OOM in dmesg\tOK\t\N\t'
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/
+ tar -chf /test_output/store.tar /var/lib/clickhouse/store
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_lx0tx06v_1.sql /var/lib/clickhouse/metadata/test_qiui6thi.sql /var/lib/clickhouse/metadata/test.sql /var/lib/clickhouse/metadata/test_vpuihec0.sql /var/lib/clickhouse/metadata/test_xkfuxk9b.sql
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ collect_core_dumps
+ find . -type f -maxdepth 1 -name 'core.*'
+ read -r core